DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG12171 and R119.3

Sequence 1:NP_649563.1 Gene:CG12171 FlyBaseID:FBgn0037354 Length:257 Species:Drosophila melanogaster
Sequence 2:NP_490726.1 Gene:R119.3 WormBaseID:WBGene00020089 Length:253 Species:Caenorhabditis elegans

Alignment Length:256 Identity:75/257 (29%)
Similarity:124/257 (48%) Gaps:27/257 (11%)


  Fly    10 IVTGASSGIGAGTSVLLAKLGGLLTIVGRNLDKLNETAEQIVAAGG---APALQVAADINSESDV 71
            :|.||:|.:|......||..|..:.......:.:.:.||..:..||   |.:|.||   |:|...
 Worm     5 LVIGATSTLGKAVVRRLAFTGYKVAAAADCPNSVGKVAEDNIKVGGDVTAFSLDVA---NAEHRK 66

  Fly    72 QGIVSATLAKHGRIDVLV-----NNAGILELGSIENTSLEQFDRVMNTNVRSLYQLTHLVTPELI 131
            : :::....|.|.:|.|:     |..    ||.|..||.|.||::...|:.:.::|:......|.
 Worm    67 E-LITKVAEKLGGLDTLIIVPPQNEV----LGEIIETSGEDFDKLFANNLTTPFRLSQAAMSTLA 126

  Fly   132 KTK-GNIVNVSSVNGIRSFPGVLAYNVSKAAVDQFTRCVALELAPKGVRVNSVNPGVIITELQRR 195
            |:: |:|:.::|..|......:..|:|:.::|...|:.||...|.:|||||||..|:|  |....
 Worm   127 KSQNGSIIYLTSCFGFTPSIDMGLYSVASSSVLSLTKSVAQSAAKQGVRVNSVVSGMI--EGDGT 189

  Fly   196 GGL------DQEAYVKFLEHAKVTHALGRPGEVKEVAAAIAFLASDEASFSTGISLPVDGG 250
            |.:      ::...:|  :|.:....|||.|...:||:.:.||||.:|.:.||.:..|.||
 Worm   190 GAVWDHASGEEARQIK--QHLESMIPLGRLGRPSDVASYVEFLASTKARYITGENCIVGGG 248

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG12171NP_649563.1 fabG 2..251 CDD:235975 75/257 (29%)
NADB_Rossmann 4..254 CDD:304358 75/257 (29%)
R119.3NP_490726.1 fabG 4..249 CDD:235500 75/257 (29%)
SDR_c 4..241 CDD:212491 72/248 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000082
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.