DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG12171 and Decr1

Sequence 1:NP_649563.1 Gene:CG12171 FlyBaseID:FBgn0037354 Length:257 Species:Drosophila melanogaster
Sequence 2:NP_476545.2 Gene:Decr1 RGDID:70999 Length:335 Species:Rattus norvegicus

Alignment Length:260 Identity:69/261 (26%)
Similarity:112/261 (43%) Gaps:25/261 (10%)


  Fly     3 SFKDKVIIVTGASSGIGAGTSVLLAKLGGLLTIVGRNLDKLNETAEQIVAAGGAPALQVAADINS 67
            :|:.||..:||..:|:|...:..|:.||....|..||:|.|..|||:|.:..|.....:..|:..
  Rat    56 AFQGKVAFITGGGTGLGKAMTTFLSSLGAQCVIASRNIDVLKATAEEITSKTGNKVYAIRCDVRD 120

  Fly    68 ESDVQGIVSATLAKHGRIDVLVNNAGILELGSIENTSLEQFDRVMNTNVRSLYQLTHLVTPELIK 132
            ...|...|...:...|..||::|||....:...|..|...:..:.:..:.....:|..:..:|||
  Rat   121 PDMVHNTVLELIKVAGHPDVVINNAAGNFISPSERLSPNGWKTITDIVLNGTAYVTLEIGKQLIK 185

  Fly   133 T-KG------NIVNVSSVNGIRSFPGVLAYNVSKAAVDQFTRCVALELAPKGVRVNSVNPGVIIT 190
            . ||      ..:...|.:|.     |:..:.:|:.|:...:.:|.|....|:|.|.:.||.|.|
  Rat   186 AQKGAAFLAITTIYAESGSGF-----VMPSSSAKSGVEAMNKSLAAEWGRYGMRFNIIQPGPIKT 245

  Fly   191 E-----LQRRGGLDQEAYVKFLEHAKVTHALGRPGEVKEVAAAIAFLASDEASFSTGISLPVDGG 250
            :     |...|..:::...:.        ..||.|.|:|:|....||.||.||:..|..:..|||
  Rat   246 KGAFSRLDPTGKFEKDMIERI--------PCGRLGTVEELANLATFLCSDYASWINGAVIRFDGG 302

  Fly   251  250
              Rat   303  302

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG12171NP_649563.1 fabG 2..251 CDD:235975 69/261 (26%)
NADB_Rossmann 4..254 CDD:304358 69/260 (27%)
Decr1NP_476545.2 TER_DECR_SDR_a 57..303 CDD:187627 69/260 (27%)
PRK07677 59..303 CDD:181077 68/258 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E2759_KOG0725
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.