DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG12171 and Pecr

Sequence 1:NP_649563.1 Gene:CG12171 FlyBaseID:FBgn0037354 Length:257 Species:Drosophila melanogaster
Sequence 2:NP_076012.3 Gene:Pecr MGIID:2148199 Length:303 Species:Mus musculus

Alignment Length:262 Identity:81/263 (31%)
Similarity:130/263 (49%) Gaps:20/263 (8%)


  Fly     5 KDKVIIVTGASSGIGAGTSVLLAKLGGLLTIVGRNLDKLNETAEQIVA----AGGAPALQVAADI 65
            |::|.:|||..:|||...|..|..||..:.|..|.||:|....:::.|    :..|....:..:|
Mouse    17 KNQVAVVTGGGTGIGKAVSRELLHLGCNVVIASRKLDRLTAAVDELRASLPPSSSAEVSAIQCNI 81

  Fly    66 NSESDVQGIVSATLAKHGRIDVLVNNAGILELGSIENTSLEQFDRVMNTNVR-SLYQLTHLVTPE 129
            ..|.:|..:|.:||||:|:|:.||||.|...:..:|:.:.:.:..|:.||:. :.|....:....
Mouse    82 RKEEEVSNLVKSTLAKYGKINFLVNNGGGQFMAPVEDITAKGWHAVIETNLTGTFYMCKEVYNSW 146

  Fly   130 LIKTKGNIVNVSSV--NGIRSFPGVLAYNVSKAAVDQFTRCVALELAPKGVRVNSVNPGVII--T 190
            :.:..|:|||:..:  ||   ||.......::..|...|:.:||..|..|||:|.|.||.|.  |
Mouse   147 MREHGGSIVNIIVLLNNG---FPTAAHTGAAREGVYNLTKSMALAWASSGVRINCVAPGTIYSQT 208

  Fly   191 ELQRRGGLDQEAYVKFLEHAKVTHALGRPGEVKEVAAAIAFLASDEASFSTGISLPVDGGR---- 251
            .:...|.:.|..:    |.|..:....|.|..:|::..:.||.|..||:.||..:.||||:    
Mouse   209 AVDNYGEMGQTLF----EMAFDSIPAKRLGVPEEISPLVCFLLSPAASYITGQLINVDGGQALYT 269

  Fly   252 HA 253
            ||
Mouse   270 HA 271

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG12171NP_649563.1 fabG 2..251 CDD:235975 79/255 (31%)
NADB_Rossmann 4..254 CDD:304358 81/263 (31%)
PecrNP_076012.3 fabG 32..267 CDD:235546 71/242 (29%)
TER_DECR_SDR_a 32..267 CDD:187627 71/242 (29%)
Microbody targeting signal. {ECO:0000250} 301..303
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E2759_KOG0725
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.