DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG12171 and hsd17b14

Sequence 1:NP_649563.1 Gene:CG12171 FlyBaseID:FBgn0037354 Length:257 Species:Drosophila melanogaster
Sequence 2:XP_002935043.1 Gene:hsd17b14 XenbaseID:XB-GENE-986127 Length:276 Species:Xenopus tropicalis

Alignment Length:261 Identity:79/262 (30%)
Similarity:129/262 (49%) Gaps:29/262 (11%)


  Fly     4 FKDKVIIVTGASSGIGAGTSVLLAKLGGLLTIVGRNLDKLNETAEQIVAAGGAPALQVAADINSE 68
            ::|:|.::||.:.|||........|.|..:....::.: ......:|.|||....:.|..|:..|
 Frog    12 YRDRVAVITGGTKGIGEAMVKEFVKSGARVVFCSKDTE-AKALENEIKAAGPGDCIYVCCDVTKE 75

  Fly    69 SDVQGIVSATLAKHGRIDVLVNNAG-ILELGSIENTSLEQFDRVMNTNVRSLYQLTHLVTPELIK 132
            .|::.::..|:..:|:||.|:|||| .....:|:.||.:.|..::|.|:...:.......|.|.|
 Frog    76 EDIKKLIEITVMNYGQIDCLINNAGWHPPEQTIDGTSADDFRDLLNLNLIGYFLTAKYALPHLRK 140

  Fly   133 TKGNIVNVSSVNGIRSFPGVLAYNVSKAAVDQFTRCVALELAPKGVRVNSVNPGVIIT------- 190
            |:|||:|:||:.||......:.|..:|.||...|:.:|::.:...||:||::||.|.|       
 Frog   141 TQGNIINISSLVGIIGQKHAIPYVATKGAVTAMTKAMAVDESRHNVRINSISPGNIWTPLWEELS 205

  Fly   191 ------ELQRRGGLDQEAYVKFLEHAKVTHALGRPGEVKEVAAAIAFLASDEASFSTGISLPVDG 249
                  |...:||:|.:             .|||.|..:|.|.|..:||: |.:|.|||.|.:.|
 Frog   206 SHSKNSEAMIQGGIDAQ-------------LLGRMGTAEECAKAALYLAA-EGTFCTGIDLLLTG 256

  Fly   250 G 250
            |
 Frog   257 G 257

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG12171NP_649563.1 fabG 2..251 CDD:235975 79/262 (30%)
NADB_Rossmann 4..254 CDD:304358 79/262 (30%)
hsd17b14XP_002935043.1 NADB_Rossmann 6..265 CDD:304358 79/262 (30%)
FabG 14..257 CDD:223959 78/258 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E2759_KOG0725
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D487970at33208
OrthoFinder 1 1.000 FOG0000082
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1710
TreeFam 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.