DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CRMP and DAL1

Sequence 1:NP_730954.2 Gene:CRMP FlyBaseID:FBgn0023023 Length:594 Species:Drosophila melanogaster
Sequence 2:NP_012293.3 Gene:DAL1 SGDID:S000001466 Length:460 Species:Saccharomyces cerevisiae

Alignment Length:487 Identity:119/488 (24%)
Similarity:192/488 (39%) Gaps:102/488 (21%)


  Fly    29 IVNHDKSFKADVY-IEDGII------KFVGPSSEITIPGGVRTID-ASGLMIIPGGIDPHTHMQL 85
            |:|........|| .|.|.|      ..|...:||| ...:.|:: .|...|:||.:|.|.|:..
Yeast    12 IINGANKPATIVYSTESGTILDVLEGSVVMEKTEIT-KYEIHTLENVSPCTILPGLVDSHVHLNE 75

  Fly    86 PFGGAVAVDDFYHGTKAAVAGGTTMIIDFVL----PNKHESMIEAYDKWRSWADPKVCCDYGLHV 146
            |  |..:.:.|..||:||::||.|.::|..|    |..:   :|.:......|:.::.||.|   
Yeast    76 P--GRTSWEGFETGTQAAISGGVTTVVDMPLNAIPPTTN---VENFRIKLEAAEGQMWCDVG--- 132

  Fly   147 GITWWSKSVSEEIGILCK--ELGVNSFKTFMAYKGLYQ---LNDSDLLDVFERIRHLNGVAMVHA 206
               :|...|...:..|..  :.||..||.|:...|:.:   :....:.:..:.:...:.:.|.||
Yeast   133 ---FWGGLVPHNLPDLIPLVKAGVRGFKGFLLDSGVEEFPPIGKEYIEEALKVLAEEDTMMMFHA 194

  Fly   207 ENGDIIAKNTQRLLAEGINGPEGHE----------------LSRPEEVEAEAVH--RACVLAHQA 253
            |.                  |:.||                .|||:..|.:|::  ..|:.|...
Yeast   195 EL------------------PKAHEDQQQPEQSHREYSSFLSSRPDSFEIDAINLILECLRARNG 241

  Fly   254 DC-PLYVVHVMSKSAGIELARARHRYRGRYIMGETLAAALG---TDATCCQHLGFDAE-----AA 309
            .. |:::||:.|..| |.|.|.              |.|.|   |..||..:|...||     |.
Yeast   242 PVPPVHIVHLASMKA-IPLIRK--------------ARASGLPVTTETCFHYLCIAAEQIPDGAT 291

  Fly   310 HV-LSPPLRPDKTTPEFLMKLLANDDLQLTGSDNCTFNKEHKALGKGDFTKIPNGVNGVEDRMSL 373
            :. ..||:| .::..:.|...|....:....||:.....|.|.|.||||.....|:..|...:.|
Yeast   292 YFKCCPPIR-SESNRQGLWDALREGVIGSVVSDHSPCTPELKNLQKGDFFDSWGGIASVGLGLPL 355

  Fly   374 VWEKGVHAGLLDPCRFVAVTS---TNAAKIFNIYPQKGRIAVGSDADIVIWNPNATRTISKDTHH 435
            ::.:|        |..|.:.:   .|.:....:..|||.||.|.|||:|:::..:...||..:.:
Yeast   356 MFTQG--------CSLVDIVTWCCKNTSHQVGLSHQKGTIAPGYDADLVVFDTASKHKISNSSVY 412

  Fly   436 HACDFNIFEGMTVHGVCEFVLVRGRICAERGN 467
            .......:.||||.|.....::||::.....|
Yeast   413 FKNKLTAYNGMTVKGTVLKTILRGQVVYTNAN 444

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CRMPNP_730954.2 D-HYD 22..475 CDD:238639 119/488 (24%)
PRK09060 24..483 CDD:181632 119/488 (24%)
DAL1NP_012293.3 PLN02795 6..456 CDD:178392 119/488 (24%)
L-HYD_ALN 9..456 CDD:238640 119/488 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0044
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 0.917438 Normalized mean entropy S1869
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.850

Return to query results.
Submit another query.