DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CRMP and PYD2

Sequence 1:NP_730954.2 Gene:CRMP FlyBaseID:FBgn0023023 Length:594 Species:Drosophila melanogaster
Sequence 2:NP_568258.2 Gene:PYD2 AraportID:AT5G12200 Length:531 Species:Arabidopsis thaliana

Alignment Length:482 Identity:215/483 (45%)
Similarity:289/483 (60%) Gaps:22/483 (5%)


  Fly    18 AQNRVYIKNGEIVNHDKSFKADVYIEDGIIKFVGPSSEITIPGGVRTIDASGLMIIPGGIDPHTH 82
            :..|:.||.|.:||......||||:|:|||..|.|:  |.:...|..:||:|..::|||||||||
plant    43 SSTRILIKGGTVVNAHHQELADVYVENGIIVAVQPN--IKVGDEVTVLDATGKFVMPGGIDPHTH 105

  Fly    83 MQLPFGGAVAVDDFYHGTKAAVAGGTTMIIDFVLPNKHESM--IEAYDKWRSWADPKVCCDYGLH 145
            :.:.|.|...:|||:.|..||:||||||.||||:|.....:  .|||:.    ...:.|.|||.|
plant   106 LAMEFMGTETIDDFFSGQAAALAGGTTMHIDFVIPVNGNLVAGFEAYEN----KSRESCMDYGFH 166

  Fly   146 VGITWWSKSVSEEIGILCKELGVNSFKTFMAYKGLYQLNDSDLLDVFERIRHLNGVAMVHAENGD 210
            :.||.|.:.||.::.:|.||.|:||||.|:||||...:.|..||:..:|.:.|..:|||||||||
plant   167 MAITKWDEGVSRDMEMLVKEKGINSFKFFLAYKGSLMVTDDLLLEGLKRCKSLGALAMVHAENGD 231

  Fly   211 IIAKNTQRLLAEGINGPEGHELSRPEEVEAEAVHRACVLAHQADCPLYVVHVMSKSAGIELARAR 275
            .:.:..:|::..||.|||||.||||..:|.||..||..||...:.|||||||||..|..|:|:||
plant   232 AVFEGQKRMIELGITGPEGHALSRPPVLEGEATARAIRLARFINTPLYVVHVMSVDAMDEIAKAR 296

  Fly   276 HRYRGRYIMGETLAAALGTDATCCQHLGFDAEAAHVLSPPLRP---DKTTPEFLMKLLANDDLQL 337
            .  .|:.::||.:.:.|..|........|...:.:|:|||:||   .|.    |...|:...|||
plant   297 K--SGQKVIGEPVVSGLILDDHWLWDPDFTIASKYVMSPPIRPVGHGKA----LQDALSTGILQL 355

  Fly   338 TGSDNCTFNKEHKALGKGDFTKIPNGVNGVEDRMSLVWEKGVHAGLLDPCRFVAVTSTNAAKIFN 402
            .|:|:||||...||||..||.:|||||||:|:||.|:|:..|.:|.|....:|.:|||..|:|||
plant   356 VGTDHCTFNSTQKALGLDDFRRIPNGVNGLEERMHLIWDTMVESGQLSATDYVRITSTECARIFN 420

  Fly   403 IYPQKGRIAVGSDADIVIWNPNATRTISKDTHHHACDFNIFEGMTVHGVCEFVLVRGRICAERGN 467
            |||:||.|..||||||:|.|||::..||..:||...|.|::||....|..|..:..|||..|...
plant   421 IYPRKGAILAGSDADIIILNPNSSYEISSKSHHSRSDTNVYEGRRGKGKVEVTIAGGRIVWENEE 485

  Fly   468 VRVAEGFGRFIPTPVRPPFVY--DIIE 492
            ::|....|::|.   .|||.|  |.||
plant   486 LKVVPRSGKYIE---MPPFSYLFDGIE 509

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CRMPNP_730954.2 D-HYD 22..475 CDD:238639 205/458 (45%)
PRK09060 24..483 CDD:181632 207/464 (45%)
PYD2NP_568258.2 PLN02795 3..483 CDD:178392 205/452 (45%)
PLN02942 41..526 CDD:178530 215/483 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 1 1.000
Homologene 1 1.000 H20359
Inparanoid 1 1.050 383 1.000 Inparanoid score I513
OMA 1 1.010
OrthoDB 1 1.010 D719800at2759
OrthoInspector 1 1.000 T192377
orthoMCL 1 0.900 OOG5_127801
Panther 1 1.100 LDO PTHR11647
Phylome 1 0.910 0.923 Consistency score
98.980

Return to query results.
Submit another query.