DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CRMP and PYR4

Sequence 1:NP_730954.2 Gene:CRMP FlyBaseID:FBgn0023023 Length:594 Species:Drosophila melanogaster
Sequence 2:NP_001327985.1 Gene:PYR4 AraportID:AT4G22930 Length:377 Species:Arabidopsis thaliana

Alignment Length:113 Identity:22/114 (19%)
Similarity:45/114 (39%) Gaps:30/114 (26%)


  Fly   497 SQPEEQHEEKQNGSM--------AKRFAELDIQIPVQEPISAMLAGNL-------AMPAEGSLCS 546
            :||::.|...::|.:        |..|....:...::.|:::..|..:       |:|:|.|.  
plant    38 TQPDDWHLHLRDGDLLHAVVPHSASNFKRAIVMPNLKPPVTSTAAAIIYRKFIMKALPSESSF-- 100

  Fly   547 TPSVRGRVDGKRDLQESSFSISEEL---DRSGVRACIKVKNPPGGKSS 591
                    |....|..:..::.||:   ..|||...:|:.  |.|.::
plant   101 --------DPLMTLYLTDKTLPEEIRLARESGVVYAVKLY--PAGATT 138

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CRMPNP_730954.2 D-HYD 22..475 CDD:238639
PRK09060 24..483 CDD:181632
PYR4NP_001327985.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D719800at2759
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.