DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CRMP and PYR4

DIOPT Version :9

Sequence 1:NP_730954.2 Gene:CRMP / 40675 FlyBaseID:FBgn0023023 Length:594 Species:Drosophila melanogaster
Sequence 2:NP_001327985.1 Gene:PYR4 / 828392 AraportID:AT4G22930 Length:377 Species:Arabidopsis thaliana


Alignment Length:113 Identity:22/113 - (19%)
Similarity:45/113 - (39%) Gaps:30/113 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   497 SQPEEQHEEKQNGSM--------AKRFAELDIQIPVQEPISAMLAGNL-------AMPAEGSLCS 546
            :||::.|...::|.:        |..|....:...::.|:::..|..:       |:|:|.|.  
plant    38 TQPDDWHLHLRDGDLLHAVVPHSASNFKRAIVMPNLKPPVTSTAAAIIYRKFIMKALPSESSF-- 100

  Fly   547 TPSVRGRVDGKRDLQESSFSISEEL---DRSGVRACIKVKNPPGGKSS 591
                    |....|..:..::.||:   ..|||...:|:.  |.|.::
plant   101 --------DPLMTLYLTDKTLPEEIRLARESGVVYAVKLY--PAGATT 138

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CRMPNP_730954.2 D-HYD 22..475 CDD:238639
PRK09060 24..483 CDD:181632
PYR4NP_001327985.1 PLN02599 13..375 CDD:178209 22/113 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D719800at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.