DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CRMP and ALN

Sequence 1:NP_730954.2 Gene:CRMP FlyBaseID:FBgn0023023 Length:594 Species:Drosophila melanogaster
Sequence 2:NP_567276.1 Gene:ALN AraportID:AT4G04955 Length:506 Species:Arabidopsis thaliana

Alignment Length:516 Identity:127/517 (25%)
Similarity:205/517 (40%) Gaps:124/517 (24%)


  Fly    14 HLQSAQNRVYIKNGEIVNHDKSFKADVYIEDGIIKFVGPSSEI----TIPGGVRTIDASGLMIIP 74
            |...:..|:...||.|       ...|.::.|||  |....|:    :....|:.||....:::|
plant    44 HYWISSKRIVTPNGLI-------SGSVEVKGGII--VSVVKEVDWHKSQRSRVKVIDYGEAVLMP 99

  Fly    75 GGIDPHTHMQLPFGGAVAVDDFYHGTKAAVAGGTTMIIDF--------VLPNKHESMIEAYDKWR 131
            |.||.|.|:..|  |....:.|..|||||.|||.|.::|.        |.|...:..|||     
plant   100 GLIDVHVHLDDP--GRSEWEGFPSGTKAAAAGGITTLVDMPLNSFPSTVSPETLKLKIEA----- 157

  Fly   132 SWADPKVCCDYGLHVGITWW---------SKSVSEEIGILCKELGVNSFKTFMAYKGLYQLNDSD 187
                    ....:||.:.:|         :.|..|.:    .:.||...|:||...|   :||..
plant   158 --------AKNRIHVDVGFWGGLVPDNALNSSALESL----LDAGVLGLKSFMCPSG---INDFP 207

  Fly   188 LLDVFERIRHLNGVA------MVHAENGDIIAKNTQRLLAEGI-NGPEGHEL---SRPEEVEAEA 242
            :.::......|:.:|      :||||    |.::.:  :.:|. |.|..:..   :||...|..|
plant   208 MTNITHIKEGLSVLAKYKRPLLVHAE----IERDLE--IEDGSENDPRSYLTYLKTRPTSWEEGA 266

  Fly   243 VHRACVL------------AHQADCPLYVVHVMSKSAGIELARARHRYRGRYIMGETLAAALGTD 295
            :.....:            ||     |::||:...|:.::|.:   ..:|:   |:::     |.
plant   267 IRNLLSVTENTRIGGSAEGAH-----LHIVHLSDASSSLDLIK---EAKGK---GDSV-----TV 315

  Fly   296 ATCCQHLGFDAE------AAHVLSPPLRPDKTTPEFLMKLLANDDLQLTGSDNCTFNKEHKALGK 354
            .||..:|.|.||      .....|||:| |....|.|.:.|...|:.:..||:.....|.|.:..
plant   316 ETCPHYLAFSAEEIPEGDTRFKCSPPIR-DAANREKLWEALMEGDIDMLSSDHSPTKPELKLMSD 379

  Fly   355 GDFTKIPNGVNGVEDRMSLVWEKGVHAGLLDPCRFVAVT---STNAAKIFNIYPQKGRIAVGSDA 416
            |:|.|...|::.::..:.:.|..|...|:    ....||   |...:|:..:: .||.:.||..|
plant   380 GNFLKAWGGISSLQFVLPITWSYGKKYGV----TLEQVTSWWSDRPSKLAGLH-SKGAVTVGKHA 439

  Fly   417 DIVIWNPNATRTISKD--THHHACDFNIFEGMTVHG--VCEFVLVRGRICAERGNVRVAEG 473
            |:|:|.|.|...:.:|  .|......:.:.|..:.|  |..||         |||:...||
plant   440 DLVVWEPEAEFDVDEDHPIHFKHPSISAYLGRRLSGKVVSTFV---------RGNLVFGEG 491

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CRMPNP_730954.2 D-HYD 22..475 CDD:238639 125/509 (25%)
PRK09060 24..483 CDD:181632 125/507 (25%)
ALNNP_567276.1 PLN02795 1..505 CDD:178392 127/517 (25%)
L-HYD_ALN 44..503 CDD:238640 127/517 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D719800at2759
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.