DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CRMP and dpysl2a

Sequence 1:NP_730954.2 Gene:CRMP FlyBaseID:FBgn0023023 Length:594 Species:Drosophila melanogaster
Sequence 2:XP_003199094.1 Gene:dpysl2a ZFINID:ZDB-GENE-100914-5 Length:573 Species:Danio rerio

Alignment Length:603 Identity:286/604 (47%)
Similarity:381/604 (63%) Gaps:62/604 (10%)


  Fly     9 KKVPIHLQSAQNRVYIKNGEIVNHDKSFKADVYIEDGIIKFVGPSSEITIPGGVRTIDASGLMII 73
            |.:|   :...:|:.||..:|||.|:||.||:|:|||:||.:|  ..:.:||||:.|:|.|.|:|
Zfish     8 KNIP---RITSDRLLIKGAKIVNDDQSFHADIYMEDGVIKQIG--ENLIVPGGVKIIEAHGRMLI 67

  Fly    74 PGGIDPHTHMQLPFGGAVAVDDFYHGTKAAVAGGTTMIIDFVLPNKHESMIEAYDKWRSWADPKV 138
            |||||.||..|:|..|..|.||||.||:||:|||||||:|.|:|....|:|.|:::||.|||.|.
Zfish    68 PGGIDVHTRFQMPDRGMTAADDFYQGTRAALAGGTTMIMDHVVPEPGFSLISAFNQWREWADQKS 132

  Fly   139 CCDYGLHVGITWWSKSVSEEIGILCKELGVNSFKTFMAYKGLYQLNDSDLLDVFERIRHLNGVAM 203
            ||||.|||.||.|.|.:.|||.:|.|:.|||||..::|||.::|||||.:.:||..||.|..:|.
Zfish   133 CCDYSLHVDITEWHKGLQEEIEMLVKDHGVNSFLVYLAYKDIFQLNDSQMYEVFSVIRDLGAIAQ 197

  Fly   204 VHAENGDIIAKNTQRLLAEGINGPEGHELSRPEEVEAEAVHRACVLAHQADCPLYVVHVMSKSAG 268
            ||||||||||:..:|:|..||.|||||.||||||||||||:||..:|:|.:||||:..||||||.
Zfish   198 VHAENGDIIAEEQKRILGLGITGPEGHVLSRPEEVEAEAVNRAVTIANQTNCPLYITKVMSKSAA 262

  Fly   269 IELARARHRYRGRYIMGETLAAALGTDATCCQHLGFDAEAAHVLSPPLRPDKTTPEFLMKLLAND 333
            ..:|:||.  :|..:.||.::|:||||.|......:...||.:.||||.||.|||::|..|||..
Zfish   263 DVIAQARK--KGTVVYGEPISASLGTDGTHYWSKNWAKAAAFITSPPLSPDPTTPDYLNSLLACG 325

  Fly   334 DLQLTGSDNCTFNKEHKALGKGDFTKIPNGVNGVEDRMSLVWEKGVHAGLLDPCRFVAVTSTNAA 398
            |||:|||.:||||...:|:||.:||.||.|.||.|:|||::|:|.|..|.:|..:||.|||||||
Zfish   326 DLQVTGSAHCTFNTSQRAVGKDNFTFIPEGTNGTEERMSIIWDKCVVTGKMDENQFVLVTSTNAA 390

  Fly   399 KIFNIYPQKGRIAVGSDADIVIWNPNATRTISKDTHHHACDFNIFEGMTVHGVCEFVLVRGRICA 463
            ||||:||:|||||||||||:|:|:|:||:.||..:||.|.::||||||.|.|....|:.:|::..
Zfish   391 KIFNLYPRKGRIAVGSDADLVLWDPDATKIISAKSHHLAVEYNIFEGMEVRGAPLVVISQGKVVL 455

  Fly   464 ERGNVRVAEGFGRFIPTPVRPPFVYDIIEGKVQSQPEEQHEEKQNGSMAKRFAELDIQIPVQEPI 528
            |.||:...||.||:|.....|.:||..|:.:                  .|.|||          
Zfish   456 EEGNLHTTEGSGRYISRKPFPDYVYKRIKAR------------------SRLAEL---------- 492

  Fly   529 SAMLAGNLAMPA---EGSLCS---TPSVRGRV-DGK-----------RDLQESSFSIS--EELDR 573
                   ..:|.   :|.:|.   ||.|...| .||           |:|.:|.||:|  :..|.
Zfish   493 -------RGVPRGLYDGPVCEVTVTPKVMTPVTSGKTSPVKPAPQPVRNLHQSGFSLSGAQVDDN 550

  Fly   574 SGVRACIKVKNPPGGKSS 591
            ...|...::..||||:::
Zfish   551 VPRRTTQRIVAPPGGRAN 568

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CRMPNP_730954.2 D-HYD 22..475 CDD:238639 251/453 (55%)
PRK09060 24..483 CDD:181632 254/459 (55%)
dpysl2aXP_003199094.1 PRK09060 18..468 CDD:181632 252/454 (56%)
D-HYD 18..467 CDD:238639 251/453 (55%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C61704273
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 561 1.000 Inparanoid score I1040
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D174151at33208
OrthoFinder 1 1.000 FOG0000190
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_127801
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.846 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
65.800

Return to query results.
Submit another query.