DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CRMP and Dpysl5

Sequence 1:NP_730954.2 Gene:CRMP FlyBaseID:FBgn0023023 Length:594 Species:Drosophila melanogaster
Sequence 2:NP_001343877.1 Gene:Dpysl5 MGIID:1929772 Length:564 Species:Mus musculus

Alignment Length:584 Identity:279/585 (48%)
Similarity:358/585 (61%) Gaps:30/585 (5%)


  Fly    17 SAQNRVYIKNGEIVNHDKSFKADVYIEDGIIKFVGPSSEITIPGGVRTIDASGLMIIPGGIDPHT 81
            ||..|:.||.|::||.|.:.:||||||.|||:.||  .|:.||||.:.|||:|.::||||||..|
Mouse     5 SASVRILIKGGKVVNDDCTHEADVYIESGIIQQVG--RELMIPGGAKVIDATGKLVIPGGIDTST 67

  Fly    82 HMQLPFGGAVAVDDFYHGTKAAVAGGTTMIIDFVLPNKHESMIEAYDKWRSWADPKVCCDYGLHV 146
            |....|..|..|||||||||||:.|||||||..|||:|..|::|||:|.|:.|||||||||.|||
Mouse    68 HFHQTFMNATCVDDFYHGTKAALVGGTTMIIGHVLPDKETSLVEAYEKCRALADPKVCCDYALHV 132

  Fly   147 GITWWSKSVSEEIGILCKELGVNSFKTFMAYKGLYQLNDSDLLDVFERIRHLNGVAMVHAENGDI 211
            |||||:..|..|:..|.:|.|||||:.||.||.||.|.||:|..||...|.:..:..||||||::
Mouse   133 GITWWAPKVKAEMETLVREKGVNSFQMFMTYKDLYMLRDSELYQVFHACRDIGAIPRVHAENGEL 197

  Fly   212 IAKNTQRLLAEGINGPEGHELSRPEEVEAEAVHRACVLAHQADCPLYVVHVMSKSAGIELARARH 276
            :|:..:..|..||.||||.|:|.|||:||||.||...:|::..||:|:|:|.|.|||..:|.|  
Mouse   198 VAEGAKEALDLGITGPEGIEISHPEELEAEATHRVITIANRTHCPIYLVNVSSISAGDVIAAA-- 260

  Fly   277 RYRGRYIMGETLAAALGTDATCCQHLGFDAEAAHVLSPPLRPDKTTPEFLMKLLANDDLQLTGSD 341
            :.:|:.::.||..|..........|..:...||:|..||||.|..|..:||.|||||.|.:..||
Mouse   261 KMQGKVVLAETTNAHATLTGLHYYHQDWSHAAAYVTVPPLRLDTNTSTYLMSLLANDTLNIVASD 325

  Fly   342 NCTFNKEHKALGKGDFTKIPNGVNGVEDRMSLVWEKGVHAGLLDPCRFVAVTSTNAAKIFNIYPQ 406
            :..|..:.||:||.||||||:||:||:||||:|||:||..|.:|..|||||||:|||||.|:||:
Mouse   326 HRPFTTKQKAMGKEDFTKIPHGVSGVQDRMSVVWERGVVGGKMDENRFVAVTSSNAAKILNLYPR 390

  Fly   407 KGRIAVGSDADIVIWNPNATRTISKDTHHHACDFNIFEGMTVHGVCEFVLVRGRICAERGNVRVA 471
            ||||..|:|||:|:|:|.||:|||..|.....|||::|.|..|||....:.|||:..|.|....|
Mouse   391 KGRIIPGADADVVVWDPEATKTISASTQVQGGDFNLYENMRCHGVPLVTISRGRVVYENGVFMCA 455

  Fly   472 EGFGRFIPTPVRPPFVYDIIEGKVQSQPEEQHEEKQNGSMAKRFAEL-DIQI---PVQEPISAML 532
            ||.|:|.|....|..||..:         .|.|:........|...| |:.|   |.::.:...|
Mouse   456 EGTGKFCPLRSFPDIVYKKL---------VQREKTLKVRGVDRTPYLGDVAIVVHPGKKEMGTPL 511

  Fly   533 AGNLAMPAEGSLCSTPSVRGRVDGKRDLQESSFSISEEL--DRSGVRACIKVKNPPGGKSSGFW 594
            |.....|..           |..|.|||.|||||:|...  |....||..::..||||:|||.|
Mouse   512 ADTPTRPVT-----------RHGGMRDLHESSFSLSGSQIDDHVPKRASARILAPPGGRSSGIW 564

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CRMPNP_730954.2 D-HYD 22..475 CDD:238639 238/453 (53%)
PRK09060 24..483 CDD:181632 241/459 (53%)
Dpysl5NP_001343877.1 D-HYD 10..459 CDD:238639 238/453 (53%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C61687475
eggNOG 1 0.900 E1_COG0044
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000190
OrthoInspector 1 1.000 T616160
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR11647
Phylome 1 0.910 0.846 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
87.800

Return to query results.
Submit another query.