DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CRMP and Dpys

Sequence 1:NP_730954.2 Gene:CRMP FlyBaseID:FBgn0023023 Length:594 Species:Drosophila melanogaster
Sequence 2:NP_113893.1 Gene:Dpys RGDID:68376 Length:519 Species:Rattus norvegicus

Alignment Length:514 Identity:283/515 (55%)
Similarity:355/515 (69%) Gaps:26/515 (5%)


  Fly    19 QNRVYIKNGEIVNHDKSFKADVYIEDGIIKFVGPSSEITIPG----GVRTIDASGLMIIPGGIDP 79
            |.|:.|:.|.:||.|.|..|||.:|||:::.:|  .::..||    |:|.:||:|.:::|||||.
  Rat     4 QERLLIRGGRVVNDDFSQVADVLVEDGVVRALG--RDLLPPGDTSRGLRILDAAGKLVLPGGIDT 66

  Fly    80 HTHMQLPFGGAVAVDDFYHGTKAAVAGGTTMIIDFVLPNKHESMIEAYDKWRSWADPKVCCDYGL 144
            |||||.||.|:.:||||:.|||||:||||||||||.:|.|..|:|||::.||:||||||||||.|
  Rat    67 HTHMQFPFMGSQSVDDFHQGTKAALAGGTTMIIDFAIPQKGSSLIEAFETWRNWADPKVCCDYSL 131

  Fly   145 HVGITWWSKSVSEEIGILCKELGVNSFKTFMAYKGLYQLNDSDLLDVFERIRHLNGVAMVHAENG 209
            ||.:||||..|.||:..|.::.||||||.|||||.||.:.|..:...|.:.:.:..:|.||||||
  Rat   132 HVAVTWWSDKVKEEMKTLAQDKGVNSFKMFMAYKDLYMVQDQQMYAAFSQCKEIGAIAQVHAENG 196

  Fly   210 DIIAKNTQRLLAEGINGPEGHELSRPEEVEAEAVHRACVLAHQADCPLYVVHVMSKSAGIELARA 274
            |:||:..:::||.||.|||||||.|||.|||||..||..:|...:||||:||||||||...:|.|
  Rat   197 DLIAEGAKKMLALGITGPEGHELCRPEAVEAEATLRAITIASAVNCPLYIVHVMSKSAAKVIADA 261

  Fly   275 RHRYRGRYIMGETLAAALGTDATCCQHLGFDAEAAHVLSPPLRPDKTTPEFLMKLLANDDLQLTG 339
            :.  .|:.:.||.:||.||||.|...:..:...|.||:.||||||.:||.|||.||||.||..||
  Rat   262 KR--EGKVVYGEPIAAGLGTDGTQYWNKEWRHAAHHVMGPPLRPDPSTPGFLMNLLANGDLTTTG 324

  Fly   340 SDNCTFNKEHKALGKGDFTKIPNGVNGVEDRMSLVWEKGVHAGLLDPCRFVAVTSTNAAKIFNIY 404
            |||||||...|||||.|||||||||||||||||::||||||:|.:|..|||||||||||||||:|
  Rat   325 SDNCTFNTCQKALGKDDFTKIPNGVNGVEDRMSVIWEKGVHSGKMDENRFVAVTSTNAAKIFNLY 389

  Fly   405 PQKGRIAVGSDADIVIWNPNATRTISKDTHHHACDFNIFEGMTVHGVCEFVLVRGRICAERGNVR 469
            |:|||||||||||:|||:|.||||||..|||.|.:|||||||..|||....:.|||:..|.|...
  Rat   390 PKKGRIAVGSDADMVIWDPEATRTISAKTHHQAVNFNIFEGMVCHGVPLVTISRGRVVYEAGVFD 454

  Fly   470 VAEGFGRFIPTPVRPPFVYDIIEGKVQS------------------QPEEQHEEKQNGS 510
            |..|.|:|||......|:|..::.:.|:                  :|.|..|:...|:
  Rat   455 VTAGHGKFIPRQPFAEFIYKRVKQRDQTCTPIPVKRAPYKGEVITLKPRETKEDDTAGT 513

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CRMPNP_730954.2 D-HYD 22..475 CDD:238639 270/457 (59%)
PRK09060 24..483 CDD:181632 274/463 (59%)
DpysNP_113893.1 D-HYD 7..460 CDD:238639 270/457 (59%)
PRK09060 7..447 CDD:181632 266/444 (60%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C61704993
eggNOG 1 0.900 E1_COG0044
Hieranoid 1 1.000
Homologene 1 1.000 H20359
Inparanoid 1 1.050 567 1.000 Inparanoid score I1013
OMA 1 1.010
OrthoDB 1 1.010 D174151at33208
OrthoFinder 1 1.000 FOG0000190
OrthoInspector 1 1.000 T618283
orthoMCL 1 0.900 OOG5_127801
Panther 1 1.100 LDO PTHR11647
Phylome 1 0.910 0.846 Consistency score
TreeFam 1 0.960
1312.770

Return to query results.
Submit another query.