DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CRMP and Dpys

Sequence 1:NP_730954.2 Gene:CRMP FlyBaseID:FBgn0023023 Length:594 Species:Drosophila melanogaster
Sequence 2:NP_001157938.1 Gene:Dpys MGIID:1928679 Length:519 Species:Mus musculus

Alignment Length:486 Identity:286/487 (59%)
Similarity:345/487 (71%) Gaps:14/487 (3%)


  Fly    19 QNRVYIKNGEIVNHDKSFKADVYIEDGIIKFVG----PSSEITIPGGVRTIDASGLMIIPGGIDP 79
            |.|:.|:.|.|||.|.|..|||.:|||:::.:|    |..:.:  .|:|.:||:|.:::|||||.
Mouse     4 QGRLLIRGGRIVNDDFSQVADVLVEDGVVRALGRDLLPPEDAS--RGLRILDAAGKLVLPGGIDT 66

  Fly    80 HTHMQLPFGGAVAVDDFYHGTKAAVAGGTTMIIDFVLPNKHESMIEAYDKWRSWADPKVCCDYGL 144
            |||||.||.|:.:|||||.|||||:||||||||||.:|.|..|:|||::.||:||||||||||.|
Mouse    67 HTHMQFPFMGSQSVDDFYQGTKAALAGGTTMIIDFAIPQKGSSLIEAFETWRNWADPKVCCDYSL 131

  Fly   145 HVGITWWSKSVSEEIGILCKELGVNSFKTFMAYKGLYQLNDSDLLDVFERIRHLNGVAMVHAENG 209
            ||.:||||..|.||:..|.::.||||||.||||||||.:.|..|...|.:.:.:..:|.||||||
Mouse   132 HVAVTWWSDKVKEEMKTLARDKGVNSFKMFMAYKGLYMVQDEQLYAAFSQCKEIGAIAQVHAENG 196

  Fly   210 DIIAKNTQRLLAEGINGPEGHELSRPEEVEAEAVHRACVLAHQADCPLYVVHVMSKSAGIELARA 274
            |:||:..:::||.||.|||||||.|||.|||||..||..:|...:|||||||||||||...:|.|
Mouse   197 DLIAEGAKKMLALGITGPEGHELCRPEAVEAEATLRAITIASAVNCPLYVVHVMSKSAAKVVADA 261

  Fly   275 RHRYRGRYIMGETLAAALGTDATCCQHLGFDAEAAHVLSPPLRPDKTTPEFLMKLLANDDLQLTG 339
            |.  .|..:.||.:||.||||........:...|.||:.||||||..||.|||.||||.||..||
Mouse   262 RR--AGNVVYGEPIAAGLGTDGRQYWSEEWSHAAHHVMGPPLRPDPLTPGFLMDLLANGDLTTTG 324

  Fly   340 SDNCTFNKEHKALGKGDFTKIPNGVNGVEDRMSLVWEKGVHAGLLDPCRFVAVTSTNAAKIFNIY 404
            |||||||...|||||.|||||||||||||||||::||||||:|.:|..|||||||||||||||:|
Mouse   325 SDNCTFNTCQKALGKDDFTKIPNGVNGVEDRMSVIWEKGVHSGKMDENRFVAVTSTNAAKIFNLY 389

  Fly   405 PQKGRIAVGSDADIVIWNPNATRTISKDTHHHACDFNIFEGMTVHGVCEFVLVRGRICAERGNVR 469
            |:|||||||||||||||:|.|||.||..|||.|.:|||||||..|||....:.|||:..|.|...
Mouse   390 PKKGRIAVGSDADIVIWDPEATRRISAKTHHQAVNFNIFEGMVCHGVPLVTISRGRVVYEAGVFN 454

  Fly   470 VAEGFGRFIPTPVRPPF---VYDIIEGKVQS 497
            |..|.|:|||   |.||   :|..|:.:.|:
Mouse   455 VTAGHGKFIP---RQPFAEYIYKRIKQRDQT 482

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CRMPNP_730954.2 D-HYD 22..475 CDD:238639 274/457 (60%)
PRK09060 24..483 CDD:181632 278/463 (60%)
DpysNP_001157938.1 D-HYD 7..460 CDD:238639 274/457 (60%)
PRK09060 7..447 CDD:181632 270/444 (61%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C61721818
eggNOG 1 0.900 E1_COG0044
Hieranoid 1 1.000
Homologene 1 1.000 H20359
Inparanoid 1 1.050 563 1.000 Inparanoid score I1068
Isobase 1 0.950 0.917438 Normalized mean entropy S1869
OMA 1 1.010
OrthoDB 1 1.010 D174151at33208
OrthoFinder 1 1.000 FOG0000190
OrthoInspector 1 1.000 T616160
orthoMCL 1 0.900 OOG5_127801
Panther 1 1.100 LDO PTHR11647
Phylome 1 0.910 0.846 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R5547
TreeFam 1 0.960
1514.750

Return to query results.
Submit another query.