DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CRMP and DPYSL5

Sequence 1:NP_730954.2 Gene:CRMP FlyBaseID:FBgn0023023 Length:594 Species:Drosophila melanogaster
Sequence 2:NP_001240652.1 Gene:DPYSL5 HGNCID:20637 Length:564 Species:Homo sapiens

Alignment Length:588 Identity:274/589 (47%)
Similarity:361/589 (61%) Gaps:38/589 (6%)


  Fly    17 SAQNRVYIKNGEIVNHDKSFKADVYIEDGIIKFVGPSSEITIPGGVRTIDASGLMIIPGGIDPHT 81
            ||..|:.||.|::||.|.:.:||||||:|||:.||  .|:.||||.:.|||:|.::||||||..|
Human     5 SASVRILIKGGKVVNDDCTHEADVYIENGIIQQVG--RELMIPGGAKVIDATGKLVIPGGIDTST 67

  Fly    82 HMQLPFGGAVAVDDFYHGTKAAVAGGTTMIIDFVLPNKHESMIEAYDKWRSWADPKVCCDYGLHV 146
            |....|..|..|||||||||||:.|||||||..|||:|..|:::||:|.|..|||||||||.|||
Human    68 HFHQTFMNATCVDDFYHGTKAALVGGTTMIIGHVLPDKETSLVDAYEKCRGLADPKVCCDYALHV 132

  Fly   147 GITWWSKSVSEEIGILCKELGVNSFKTFMAYKGLYQLNDSDLLDVFERIRHLNGVAMVHAENGDI 211
            |||||:..|..|:..|.:|.|||||:.||.||.||.|.||:|..|....:.:..:|.||||||::
Human   133 GITWWAPKVKAEMETLVREKGVNSFQMFMTYKDLYMLRDSELYQVLHACKDIGAIARVHAENGEL 197

  Fly   212 IAKNTQRLLAEGINGPEGHELSRPEEVEAEAVHRACVLAHQADCPLYVVHVMSKSAGIELARARH 276
            :|:..:..|..||.||||.|:|||||:||||.||...:|::..||:|:|:|.|.|||..:|.|  
Human   198 VAEGAKEALDLGITGPEGIEISRPEELEAEATHRVITIANRTHCPIYLVNVSSISAGDVIAAA-- 260

  Fly   277 RYRGRYIMGETLAAALGTDATCCQHLGFDAEAAHVLSPPLRPDKTTPEFLMKLLANDDLQLTGSD 341
            :.:|:.::.||..|..........|..:...||:|..||||.|..|..:||.|||||.|.:..||
Human   261 KMQGKVVLAETTTAHATLTGLHYYHQDWSHAAAYVTVPPLRLDTNTSTYLMSLLANDTLNIVASD 325

  Fly   342 NCTFNKEHKALGKGDFTKIPNGVNGVEDRMSLVWEKGVHAGLLDPCRFVAVTSTNAAKIFNIYPQ 406
            :..|..:.||:||.||||||:||:||:||||::||:||..|.:|..|||||||:||||:.|:||:
Human   326 HRPFTTKQKAMGKEDFTKIPHGVSGVQDRMSVIWERGVVGGKMDENRFVAVTSSNAAKLLNLYPR 390

  Fly   407 KGRIAVGSDADIVIWNPNATRTISKDTHHHACDFNIFEGMTVHGVCEFVLVRGRICAERGNVRVA 471
            ||||..|:|||:|:|:|.||:|||..|.....|||::|.|..|||....:.|||:..|.|....|
Human   391 KGRIIPGADADVVVWDPEATKTISASTQVQGGDFNLYENMRCHGVPLVTISRGRVVYENGVFMCA 455

  Fly   472 EGFGRFIPTPVRPPFVYDIIEGKVQSQPEEQHEEKQNGSMAKRFAELDIQIPVQEPISAMLAGNL 536
            ||.|:|.|....|..||                        |:..:.:..:.|:........|::
Human   456 EGTGKFCPLRSFPDTVY------------------------KKLVQREKTLKVRGVDRTPYLGDV 496

  Fly   537 AM---PAEGS----LCSTPS-VRGRVDGKRDLQESSFSISEEL--DRSGVRACIKVKNPPGGKSS 591
            |:   |.:..    |..||: ...|..|.|||.|||||:|...  |....||..::..||||:||
Human   497 AVVVHPGKKEMGTPLADTPTRPVTRHGGMRDLHESSFSLSGSQIDDHVPKRASARILAPPGGRSS 561

  Fly   592 GFW 594
            |.|
Human   562 GIW 564

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CRMPNP_730954.2 D-HYD 22..475 CDD:238639 235/453 (52%)
PRK09060 24..483 CDD:181632 238/459 (52%)
DPYSL5NP_001240652.1 D-HYD 10..459 CDD:238639 235/453 (52%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C61679936
eggNOG 1 0.900 E1_COG0044
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 571 1.000 Inparanoid score I1039
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D174151at33208
OrthoFinder 1 1.000 FOG0000190
OrthoInspector 1 1.000 T609346
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR11647
Phylome 1 0.910 0.846 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
User_Submission 00.000 Not matched by this tool.
109.860

Return to query results.
Submit another query.