DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CRMP and crmp1

Sequence 1:NP_730954.2 Gene:CRMP FlyBaseID:FBgn0023023 Length:594 Species:Drosophila melanogaster
Sequence 2:XP_005159900.1 Gene:crmp1 ZFINID:ZDB-GENE-050720-1 Length:674 Species:Danio rerio

Alignment Length:587 Identity:271/588 (46%)
Similarity:363/588 (62%) Gaps:51/588 (9%)


  Fly    21 RVYIKNGEIVNHDKSFKADVYIEDGIIKFVGPSSEITIPGGVRTIDASGLMIIPGGIDPHTHMQL 85
            |:.||.|.:||.|:|..||||:||||||.||  ..:.:||||:.|:|:|.|:||||||.:|.:..
Zfish   118 RLLIKGGRVVNDDQSLYADVYVEDGIIKQVG--ENLIVPGGVKVIEANGCMVIPGGIDVNTCLHK 180

  Fly    86 PFGGAVAVDDFYHGTKAAVAGGTTMIIDFVLPNKHESMIEAYDKWRSWADPKVCCDYGLHVGITW 150
            |:.|...|||||.|||||:|||||||||.|.|...:.::||::||:..||.|.||||.|||.|..
Zfish   181 PYLGTPPVDDFYQGTKAALAGGTTMIIDHVTPQPGDGLLEAFEKWQEAADKKSCCDYSLHVDIPH 245

  Fly   151 WSKSVSEEIGILCKELGVNSFKTFMAYKGLYQLNDSDLLDVFERIRHLNGVAMVHAENGDIIAKN 215
            |.:.|.||:..|.:|.|:|||:.:||||||||:.||.|.:.|..::.|..|.:|||||||:||:.
Zfish   246 WHEGVKEELEQLVQEKGINSFQVYMAYKGLYQMPDSQLYEAFSFLKELGAVVLVHAENGDLIAQE 310

  Fly   216 TQRLLAEGINGPEGHELSRPEEVEAEAVHRACVLAHQADCPLYVVHVMSKSAGIELARARHRYRG 280
            ..::|..||.|||||.||||||:|||||.||..:.::.:||:|:..||||||...:|.||.  :|
Zfish   311 QSKILGMGIIGPEGHPLSRPEELEAEAVFRAITIGNRVNCPVYITKVMSKSAAETVAIARK--KG 373

  Fly   281 RYIMGETLAAALGTDATCCQHLGFDAEAAHVLSPPLRPDKTTPEFLMKLLANDDLQLTGSDNCTF 345
            ..:.||.:.|:|.||.:......:...||:|.||||.||.||||.|..|||..|||:.||.:|.:
Zfish   374 SVVFGEPITASLATDGSHYWSKNWAKAAAYVTSPPLSPDPTTPEHLHSLLACGDLQVVGSGHCAY 438

  Fly   346 NKEHKALGKGDFTKIPNGVNGVEDRMSLVWEKGVHAGLLDPCRFVAVTSTNAAKIFNIYPQKGRI 410
            :...||:||.:||.||.|.||||:||..||:|.|..|.:|..:||||||||||||||:||:||||
Zfish   439 STSQKAIGKDNFTLIPEGTNGVEERMGFVWDKAVAMGKMDENQFVAVTSTNAAKIFNLYPRKGRI 503

  Fly   411 AVGSDADIVIWNPNATRTISKDTHHHACDFNIFEGMTVHGVCEFVLVRGRICAERGNVRVAEGFG 475
            |||||||||||:|:..:||:..:...|.::||||||...|....|:.:||:..|.|.::|.:|.|
Zfish   504 AVGSDADIVIWDPDKIKTITAKSQQSALEYNIFEGMDCRGGPLHVVSQGRVVFEEGKLQVQQGTG 568

  Fly   476 RFIPTPVRPPFVYDIIE--GKVQSQPEEQHEEKQNGSMAKRFAELDIQIPVQEPISAMLAGNL-A 537
            |||.....|.|.|..|:  .|:.:                          :|.....|..|.: .
Zfish   569 RFISRKPFPDFAYQRIKYRNKIMN--------------------------MQGVSRGMYDGPVYD 607

  Fly   538 MPAEGSLCSTPSVRGRVDGK-------RDLQESSFSIS-EELD-----RSGVRACIKVKNPPGGK 589
            :||..... ||:...:....       |:|.:|:||:| .::|     |||.|    :..||||:
Zfish   608 VPATPKYI-TPAPSAKTSPTTHQPPPIRNLHQSNFSLSGSQIDDNIPRRSGHR----IVAPPGGR 667

  Fly   590 SS 591
            |:
Zfish   668 SN 669

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CRMPNP_730954.2 D-HYD 22..475 CDD:238639 238/453 (53%)
PRK09060 24..483 CDD:181632 242/459 (53%)
crmp1XP_005159900.1 PRK09060 119..569 CDD:181632 239/454 (53%)
D-HYD 119..568 CDD:238639 238/453 (53%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C61692284
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 561 1.000 Inparanoid score I1040
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D174151at33208
OrthoFinder 1 1.000 FOG0000190
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_127801
Panther 1 1.100 O PTHR11647
Phylome 1 0.910 0.846 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
76.900

Return to query results.
Submit another query.