DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CRMP and dpysl2b

Sequence 1:NP_730954.2 Gene:CRMP FlyBaseID:FBgn0023023 Length:594 Species:Drosophila melanogaster
Sequence 2:XP_005155688.1 Gene:dpysl2b ZFINID:ZDB-GENE-031105-1 Length:643 Species:Danio rerio

Alignment Length:593 Identity:281/594 (47%)
Similarity:384/594 (65%) Gaps:39/594 (7%)


  Fly     9 KKVPIHLQSAQNRVYIKNGEIVNHDKSFKADVYIEDGIIKFVGPSSEITIPGGVRTIDASGLMII 73
            |::..:|....:|:.||..:|||.|:||.||:|:|||:||.:|  ..:.:||||:||||.|.|::
Zfish    75 KELLQNLNDESDRLLIKGAKIVNDDQSFCADIYMEDGLIKQIG--ENLIVPGGVKTIDAHGRMVM 137

  Fly    74 PGGIDPHTHMQLPFGGAVAVDDFYHGTKAAVAGGTTMIIDFVLPNKHESMIEAYDKWRSWADPKV 138
            |||||.||..|:|..|..|.||||.||:||:|||||||:|.|:|....|:|.|:::||.|||.|.
Zfish   138 PGGIDVHTRFQMPDRGMTAADDFYQGTRAALAGGTTMIVDHVVPEPGTSLISAFNQWREWADSKA 202

  Fly   139 CCDYGLHVGITWWSKSVSEEIGILCKELGVNSFKTFMAYKGLYQLNDSDLLDVFERIRHLNGVAM 203
            ||||.|||.||.|.|.|.||:..|.|:.|||||..::|||..:||.||.:.:||..||.|..:|.
Zfish   203 CCDYSLHVDITEWHKGVQEEMEALVKDHGVNSFLVYLAYKDFFQLTDSQIYEVFSVIRDLGAIAQ 267

  Fly   204 VHAENGDIIAKNTQRLLAEGINGPEGHELSRPEEVEAEAVHRACVLAHQADCPLYVVHVMSKSAG 268
            ||||||||||:..:|:|..||.|||||.||||||||||||:|:..:|:|.:||||:..||||||.
Zfish   268 VHAENGDIIAEEQRRILDLGITGPEGHVLSRPEEVEAEAVNRSVTVANQTNCPLYITKVMSKSAA 332

  Fly   269 IELARARHRYRGRYIMGETLAAALGTDATCCQHLGFDAEAAHVLSPPLRPDKTTPEFLMKLLAND 333
            ..:|:||.  :|..:.||.:.|::|||.:......:...||:|.||||.||.|||::|..||:..
Zfish   333 DVIAQARK--KGTVVYGEPITASIGTDGSHYWSKNWAKAAAYVTSPPLSPDPTTPDYLNSLLSCG 395

  Fly   334 DLQLTGSDNCTFNKEHKALGKGDFTKIPNGVNGVEDRMSLVWEKGVHAGLLDPCRFVAVTSTNAA 398
            |||:|||.:||||...:|:||.|||.||.|.||.|:|||::|:|.|..|.:|..:||||||||||
Zfish   396 DLQVTGSAHCTFNTSQRAVGKDDFTLIPEGTNGTEERMSIIWDKCVVTGKMDENQFVAVTSTNAA 460

  Fly   399 KIFNIYPQKGRIAVGSDADIVIWNPNATRTISKDTHHHACDFNIFEGMTVHGVCEFVLVRGRICA 463
            ||||:||:|||||||||||:|:|:|:.|:.||..:|:.|.::||||||.|.||...|:.:|:|..
Zfish   461 KIFNLYPRKGRIAVGSDADLVLWDPDVTKIISAKSHNLAVEYNIFEGMEVRGVPLVVISQGKIVL 525

  Fly   464 ERGNVRVAEGFGRFIPTPVRPPFVYDIIEGKVQSQPEEQHEEKQNGSMAKRFAELDIQIP---VQ 525
            |.|.:...||.||||.....|.:||..|:.:                  .|.|||. .:|   ..
Zfish   526 EEGTLHTTEGSGRFISRKPFPDYVYKRIKAR------------------SRLAELR-GVPRGLYD 571

  Fly   526 EPISAMLAGNLAMPAEGSLCSTPSVRGRVDGK--RDLQESSFSIS-----EELDRSGVRACIKVK 583
            .|:..:.....|:....|..::|:   :..|:  |:|.:|.||:|     :.:.|...:   ::.
Zfish   572 GPVCEVSVTPKAVTPASSAKTSPA---KQPGQPVRNLHQSGFSLSGAQVDDNIPRRNTQ---RIV 630

  Fly   584 NPPGGKSS 591
            .||||:::
Zfish   631 APPGGRAN 638

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CRMPNP_730954.2 D-HYD 22..475 CDD:238639 249/453 (55%)
PRK09060 24..483 CDD:181632 253/459 (55%)
dpysl2bXP_005155688.1 PRK09060 88..538 CDD:181632 250/454 (55%)
D-HYD 88..537 CDD:238639 249/453 (55%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C61703135
eggNOG 1 0.900 E1_COG0044
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D174151at33208
OrthoFinder 1 1.000 FOG0000190
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_127801
Panther 1 1.100 O PTHR11647
Phylome 1 0.910 0.846 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
76.750

Return to query results.
Submit another query.