DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CRMP and dpysl4

Sequence 1:NP_730954.2 Gene:CRMP FlyBaseID:FBgn0023023 Length:594 Species:Drosophila melanogaster
Sequence 2:XP_021335783.1 Gene:dpysl4 ZFINID:ZDB-GENE-050720-3 Length:675 Species:Danio rerio

Alignment Length:584 Identity:282/585 (48%)
Similarity:371/585 (63%) Gaps:41/585 (7%)


  Fly    20 NRVYIKNGEIVNHDKSFKADVYIEDGIIKFVGPSSEITIPGGVRTIDASGLMIIPGGIDPHTHMQ 84
            :::.||.|:|||.|:||.||:|:||||||.:|  ..:.:|.||:|:||.|.::||||||.:|.:|
Zfish   116 DKLIIKGGKIVNDDQSFYADIYVEDGIIKQIG--ENLIVPTGVKTVDAYGHIVIPGGIDVNTCLQ 178

  Fly    85 LPFGGAVAVDDFYHGTKAAVAGGTTMIIDFVLPNKHESMIEAYDKWRSWADPKVCCDYGLHVGIT 149
            .|..|....|||||||:||:|||||||||.|:|....|::.|:|:|:..||.:.||||.||:.||
Zfish   179 APHLGMSPADDFYHGTRAALAGGTTMIIDHVVPEPGSSLLSAFDQWKDTADKRSCCDYSLHIDIT 243

  Fly   150 WWSKSVSEEIGILCKELGVNSFKTFMAYKGLYQLNDSDLLDVFERIRHLNGVAMVHAENGDIIAK 214
            .|...:.||:..|.|:.|||||..|||||..:|.:|:.:.::|..:|.|..:|.|||||||||.:
Zfish   244 RWHDGLFEELESLVKDKGVNSFLIFMAYKDKFQSSDTQIYEMFSAMRELGAIAQVHAENGDIIEE 308

  Fly   215 NTQRLLAEGINGPEGHELSRPEEVEAEAVHRACVLAHQADCPLYVVHVMSKSAGIELARARHRYR 279
            ..::||..||.|||||.||.|||||.|||:||..:|.||:||||:..||||.|...:|:||.  :
Zfish   309 EQKKLLDLGITGPEGHVLSHPEEVETEAVYRAITIAKQANCPLYITKVMSKPAADLIAKARK--K 371

  Fly   280 GRYIMGETLAAALGTDATCCQHLGFDAEAAHVLSPPLRPDKTTPEFLMKLLANDDLQLTGSDNCT 344
            |..|.||.:||:||||.:......:...||.|:||||.||.:||::|..||:..|||:|.|.|||
Zfish   372 GMVIYGEPIAASLGTDGSHYWSKNWAEAAAFVMSPPLNPDTSTPDYLNSLLSCGDLQVTASANCT 436

  Fly   345 FNKEHKALGKGDFTKIPNGVNGVEDRMSLVWEKGVHAGLLDPCRFVAVTSTNAAKIFNIYPQKGR 409
            |....||:||.|||.||.|.||:|:|||:||:|.|..|.:|...||||||||||||||:||:|||
Zfish   437 FTTAQKAVGKDDFTFIPEGTNGIEERMSIVWDKAVATGKMDENDFVAVTSTNAAKIFNLYPRKGR 501

  Fly   410 IAVGSDADIVIWNPNATRTISKDTHHHACDFNIFEGMTVHGVCEFVLVRGRICAERGNVRVAEGF 474
            |||||||||||||...|||.|..||:...:.||||||...|....|:.:|||..|.|.:.|.||.
Zfish   502 IAVGSDADIVIWNTKETRTFSAKTHNLTVEVNIFEGMECRGFPVLVISQGRIVLEDGTLSVMEGS 566

  Fly   475 GRFIPTPVRPPFVYDIIEGKVQSQPEEQHEEKQNGSMAKRFAELDIQIPVQEPISAMLAGNLAMP 539
            |||||....|.:||..|  |.:|:..:          |:.....:...||.:.||.    ..::|
Zfish   567 GRFIPRKAYPDYVYKRI--KARSRMAD----------ARGVPRGNYDGPVHDVISM----TKSVP 615

  Fly   540 AEGSLCSTPSVRG-RVDGK------RDLQESSFSIS-----EELDRSGVRACIKVKNPPGGKSS 591
            |      ||:.|| ...||      |:|.:|.|::|     :.:.|   |...|:..||||:|:
Zfish   616 A------TPTTRGPSCPGKTPLGPTRNLHQSGFTLSGTQMDDHIPR---RTAQKIVAPPGGRSN 670

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CRMPNP_730954.2 D-HYD 22..475 CDD:238639 245/453 (54%)
PRK09060 24..483 CDD:181632 250/459 (54%)
dpysl4XP_021335783.1 D-HYD 118..567 CDD:238639 245/453 (54%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C61716444
eggNOG 1 0.900 E1_COG0044
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 561 1.000 Inparanoid score I1040
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D174151at33208
OrthoFinder 1 1.000 FOG0000190
OrthoInspector 1 1.000 T596953
orthoMCL 1 0.900 OOG5_127801
Panther 1 1.100 O PTHR11647
Phylome 1 0.910 0.846 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
109.800

Return to query results.
Submit another query.