DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CRMP and dpysl5b

Sequence 1:NP_730954.2 Gene:CRMP FlyBaseID:FBgn0023023 Length:594 Species:Drosophila melanogaster
Sequence 2:NP_001018351.1 Gene:dpysl5b ZFINID:ZDB-GENE-050720-4 Length:568 Species:Danio rerio

Alignment Length:587 Identity:254/588 (43%)
Similarity:356/588 (61%) Gaps:41/588 (7%)


  Fly    21 RVYIKNGEIVNHDKSFKADVYIEDGIIKFVGPSSEITIPGGVRTIDASGLMIIPGGIDPHTHMQL 85
            |:.||.|.:||.|.:.:||||:|:|.|:.||  .::.||||.:.|||:|.::||||||...|:..
Zfish    10 RILIKGGRVVNDDVTEEADVYLENGRIQQVG--RDLMIPGGAKVIDATGKLVIPGGIDSSVHLHQ 72

  Fly    86 PFGGAVAVDDFYHGTKAAVAGGTTMIIDFVLPNKHESMIEAYDKWRSWADPKVCCDYGLHVGITW 150
            .|..|...||||.|||||:.||:||:|..|||::..|:::|:::.|:.||.|.||||.||||:||
Zfish    73 TFMNAHTQDDFYSGTKAALLGGSTMLISHVLPDRGASLLDAFEQMRAHADAKACCDYALHVGVTW 137

  Fly   151 WSKSVSEEIGILCKELGVNSFKTFMAYKGLYQLNDSDLLDVFERIRHLNGVAMVHAENGDIIAKN 215
            |...|..|:.:|..|.|||||:.|||||....|.||:|.......:::..:|.:|||||:::.:.
Zfish   138 WGPKVEREMEVLVGERGVNSFQMFMAYKDAMMLKDSELYQALNTCKNIGAIARIHAENGELVLEG 202

  Fly   216 TQRLLAEGINGPEGHELSRPEEVEAEAVHRACVLAHQADCPLYVVHVMSKSAGIELARARHRYRG 280
            .:..|..||:||||.|:|||||:||||.|||..:.::|.||:|:|:|.|.||...:..|  |.:|
Zfish   203 AKEALDLGISGPEGMEISRPEELEAEATHRAITIGNRAHCPVYLVNVSSMSAADVIGAA--RMQG 265

  Fly   281 RYIMGETLAAALGTDATCCQHLGFDAEAAHVLSPPLRPDKTTPEFLMKLLANDDLQLTGSDNCTF 345
            :.:..||..|..........|..:...||||::||||.|..||:.|:.||.||.:.:..||:..|
Zfish   266 KVVQAETTVAHAVLSGMHYYHQDWAHAAAHVIAPPLRLDPNTPDHLIGLLGNDIINVVASDHRAF 330

  Fly   346 NKEHKALGKGDFTKIPNGVNGVEDRMSLVWEKGVHAGLLDPCRFVAVTSTNAAKIFNIYPQKGRI 410
            :.:.||:||.||||||:|..|||||||::||:||.:|.:|..|||||||:|||||:|:||:||||
Zfish   331 STKQKAMGKEDFTKIPHGAPGVEDRMSVIWERGVVSGKMDENRFVAVTSSNAAKIYNLYPRKGRI 395

  Fly   411 AVGSDADIVIWNPNATRTISKDTHHHACDFNIFEGMTVHGVCEFVLVRGRICAERGNVRVAEGFG 475
            ..|:|||:|:|:|:||||||..|.....|||:|||...|||....:.|||:..|.|....|:|.|
Zfish   396 MPGADADVVVWDPDATRTISASTQAQGGDFNLFEGQRCHGVPLVTISRGRLVCENGVFMCAQGSG 460

  Fly   476 RFIPTPVRPPFVYDIIEGKVQSQPEEQHEEKQNGSMAKRFAELDIQIPVQEPISAMLAGNLAM-- 538
            :|.|....|.|:|                        |:..:.:..:.|:....|..:|::|.  
Zfish   461 KFYPMRAFPDFLY------------------------KKLIQREKTLAVRGVDRAPYSGDVASVM 501

  Fly   539 --------PAEGSL-CSTPSVRGRVDGKRDLQESSFSIS--EELDRSGVRACIKVKNPPGGKSSG 592
                    ..||.: ..|.:...|..|.|||.|||||:|  :..|....|:..::..||||:|||
Zfish   502 SSIRKESGSPEGDVPMRTAATAARHTGIRDLHESSFSLSGAQVDDHIPKRSSARILAPPGGRSSG 566

  Fly   593 FW 594
            .|
Zfish   567 IW 568

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CRMPNP_730954.2 D-HYD 22..475 CDD:238639 218/453 (48%)
PRK09060 24..483 CDD:181632 221/459 (48%)
dpysl5bNP_001018351.1 D-HYD 11..460 CDD:238639 218/453 (48%)
PRK09060 12..451 CDD:181632 215/443 (49%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C61691878
eggNOG 1 0.900 E1_COG0044
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 561 1.000 Inparanoid score I1040
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D174151at33208
OrthoFinder 1 1.000 FOG0000190
OrthoInspector 1 1.000 T596953
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR11647
Phylome 1 0.910 0.846 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
ZFIN 00.000 Not matched by this tool.
109.860

Return to query results.
Submit another query.