DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CRMP and dpysl3

Sequence 1:NP_730954.2 Gene:CRMP FlyBaseID:FBgn0023023 Length:594 Species:Drosophila melanogaster
Sequence 2:NP_001018348.1 Gene:dpysl3 ZFINID:ZDB-GENE-050720-2 Length:567 Species:Danio rerio

Alignment Length:596 Identity:284/597 (48%)
Similarity:379/597 (63%) Gaps:53/597 (9%)


  Fly     9 KKVPIHLQSAQNRVYIKNGEIVNHDKSFKADVYIEDGIIKFVGPSSEITIPGGVRTIDASGLMII 73
            |.:|   :....|:.||.|.|||.|:||.||:|:|||:||.:|  ..:.:||||:||:|:|.|:|
Zfish     7 KNIP---KITSERLLIKGGRIVNDDQSFYADIYMEDGVIKQIG--DNLIVPGGVKTIEANGKMVI 66

  Fly    74 PGGIDPHTHMQLPFGGAVAVDDFYHGTKAAVAGGTTMIIDFVLPNKHESMIEAYDKWRSWADPKV 138
            |||||.|||:|:||.|....|||..|||||:|||||||:|.|:|....|::||:|:|..|||.|.
Zfish    67 PGGIDIHTHLQMPFRGTTTADDFTQGTKAALAGGTTMIVDHVIPEPGCSLLEAFDRWSKWADEKA 131

  Fly   139 CCDYGLHVGITWWSKSVSEEIGILCKELGVNSFKTFMAYKGLYQLNDSDLLDVFERIRHLNGVAM 203
            ||||.|||.||.|:.||.:|:..|.||.|||||:.:||:|.|||:::::|.:||..:....|:|.
Zfish   132 CCDYSLHVDITHWNDSVKQEVETLIKEKGVNSFQVYMAFKDLYQMSNTELYEVFTFLGEHGGIAQ 196

  Fly   204 VHAENGDIIAKNTQRLLAEGINGPEGHELSRPEEVEAEAVHRACVLAHQADCPLYVVHVMSKSAG 268
            ||||||:|||:...|:|..||.|||||.||||||:|||||.||..:|.|.:|||||..||||||.
Zfish   197 VHAENGEIIAEEQARMLEMGITGPEGHVLSRPEELEAEAVFRAVTIASQTNCPLYVTRVMSKSAA 261

  Fly   269 IELARARHRYRGRYIMGETLAAALGTDATCCQHLGFDAEAAHVLSPPLRPDKTTPEFLMKLLAND 333
            ..:::||.  :|..:.||.:.|:||||.|......:...|:.|.||||.||.|||::|..|||:.
Zfish   262 DIISQARK--KGNVVFGEPITASLGTDGTHYWSKNWAKAASFVTSPPLSPDPTTPDYLNTLLASG 324

  Fly   334 DLQLTGSDNCTFNKEHKALGKGDFTKIPNGVNGVEDRMSLVWEKGVHAGLLDPCRFVAVTSTNAA 398
            ||.:.||.:|||:...||:||.|||:||.||||.|:|||::|:|.|..|.:|...||||||||||
Zfish   325 DLSVVGSAHCTFSVAQKAIGKDDFTQIPEGVNGAEERMSIIWDKAVVTGKMDENMFVAVTSTNAA 389

  Fly   399 KIFNIYPQKGRIAVGSDADIVIWNPNATRTISKDTHHHACDFNIFEGMTVHGVCEFVLVRGRICA 463
            ||.|:||:|||||||||:|:|||:.:|.|||:..|||.|.::|:||||.:.|....|:.:|:|..
Zfish   390 KILNLYPRKGRIAVGSDSDLVIWDTDAVRTITAKTHHSAAEYNVFEGMELRGAPMLVVCQGKIVL 454

  Fly   464 ERGNVRVAEGFGRFIPTPVRPPFVYDIIEGKVQ-----SQPEEQHEEKQNGSMAKRFAELDIQIP 523
            |.||:....|.|||||....|.|.|..::.:.|     :.|...::.                 |
Zfish   455 EDGNLHATSGTGRFIPCSPFPDFAYKRVKARKQLAILKAVPRGMYDG-----------------P 502

  Fly   524 VQEPISAMLAGNLAMPAEGSLCSTPSVRGRVDGK----RDLQESSFSIS--EE--LDRSGVRACI 580
            |.| .|.|..|           .|||...|....    |:|.:|.|::|  ||  :..:|.|..:
Zfish   503 VSE-FSPMSRG-----------GTPSASTRTSPTKVPVRNLHQSGFTLSGPEEAPIRPAGRRIVV 555

  Fly   581 KVKNPPGGKSS 591
                ||||:|:
Zfish   556 ----PPGGRSN 562

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CRMPNP_730954.2 D-HYD 22..475 CDD:238639 247/453 (55%)
PRK09060 24..483 CDD:181632 252/459 (55%)
dpysl3NP_001018348.1 PRK09060 17..467 CDD:181632 248/454 (55%)
D-HYD 17..466 CDD:238639 247/453 (55%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C61672346
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 561 1.000 Inparanoid score I1040
OMA 1 1.010
OrthoDB 1 1.010 D174151at33208
OrthoFinder 1 1.000 FOG0000190
OrthoInspector 1 1.000 T596953
orthoMCL 1 0.900 OOG5_127801
Panther 1 1.100 O PTHR11647
Phylome 1 0.910 0.846 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R5547
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
1110.940

Return to query results.
Submit another query.