DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CRMP and dpysl4

Sequence 1:NP_730954.2 Gene:CRMP FlyBaseID:FBgn0023023 Length:594 Species:Drosophila melanogaster
Sequence 2:NP_001015765.1 Gene:dpysl4 XenbaseID:XB-GENE-960292 Length:573 Species:Xenopus tropicalis

Alignment Length:604 Identity:283/605 (47%)
Similarity:379/605 (63%) Gaps:63/605 (10%)


  Fly     9 KKVPIHLQSAQNRVYIKNGEIVNHDKSFKADVYIEDGIIKFVGPSSEITIPGGVRTIDASGLMII 73
            |.:|   :...:|:.||.|:|||.|:||.||:|||||:||.:|  ..:.:||||:||||.||::|
 Frog     7 KSIP---RLTSDRLLIKGGKIVNDDQSFLADIYIEDGLIKQIG--ENLIVPGGVKTIDAHGLLVI 66

  Fly    74 PGGIDPHTHMQLPFGGAVAVDDFYHGTKAAVAGGTTMIIDFVLPNKHESMIEAYDKWRSWADPKV 138
            |||||.||.:|:|..|..:.|||:.|||||:|||||||||.|.|:...::::|||:||.|||.||
 Frog    67 PGGIDVHTRLQMPVMGMTSADDFFQGTKAALAGGTTMIIDHVFPDSGMNLVQAYDQWREWADGKV 131

  Fly   139 CCDYGLHVGITWWSKSVSEEIGILCKELGVNSFKTFMAYKGLYQLNDSDLLDVFERIRHLNGVAM 203
            ||||.||:.||:|.:|:.||:..|.|:.|||||..|||||..||..|:::.::|..||.|..:|.
 Frog   132 CCDYSLHIDITYWHESLKEELEALVKDKGVNSFLVFMAYKDQYQCTDAEMYEIFSIIRDLGAIAQ 196

  Fly   204 VHAENGDIIAKNTQRLLAEGINGPEGHELSRPEEVEAEAVHRACVLAHQADCPLYVVHVMSKSAG 268
            |||||||||.:..:|:|..||.|||||.||.||||||||.:||..:|.||:||||:..|||:.|.
 Frog   197 VHAENGDIIQEEQKRMLECGITGPEGHVLSHPEEVEAEAAYRAITIAKQANCPLYITKVMSRGAA 261

  Fly   269 IELARARHRYRGRYIMGETLAAALGTDATCCQHLGFDAEAAHVLSPPLRPDKTTPEFLMKLLAND 333
            ..:|:|:.  :|..:.||||.|::|||.|......:...||:|.|||:.||.:||:.|..||:..
 Frog   262 DVIAQAKR--KGIVVYGETLTASIGTDGTHYWSKNWAKAAAYVTSPPISPDPSTPDHLTSLLSCG 324

  Fly   334 DLQLTGSDNCTFNKEHKALGKGDFTKIPNGVNGVEDRMSLVWEKGVHAGLLDPCRFVAVTSTNAA 398
            ||.:|||.:|||....||:||.:|..||.|.||:|:||:::|:|.|.:|.:|...||||||||||
 Frog   325 DLHVTGSAHCTFTTAQKAVGKDNFILIPEGTNGIEERMTIIWDKCVTSGKMDENAFVAVTSTNAA 389

  Fly   399 KIFNIYPQKGRIAVGSDADIVIWNPNATRTISKDTHHHACDFNIFEGMTVHGVCEFVLVRGRICA 463
            |:||:||:|||||.|||||:|||||...:.||..||:...:.||||||..||..|.|:.:|||..
 Frog   390 KLFNLYPRKGRIATGSDADLVIWNPKTAKIISAKTHNMNVELNIFEGMECHGAPEVVISQGRIVL 454

  Fly   464 ERGNVRVAEGFGRFIPTPVRPPFVYDIIEGKVQSQPEEQHEEKQNGSMAKRFAEL---------- 518
            |.||:.|::|.|||:|....|.:||..|:.:                  .|.||:          
 Frog   455 EDGNLHVSQGSGRFVPRKTFPDYVYKRIKAR------------------NRLAEIRGVPRGLYDG 501

  Fly   519 ---DIQIPVQEPISAMLAGNLAMPAEGSLCSTPSVRGRVDGK------RDLQESSFSI--SEELD 572
               |:.|..:                 |..|||:.|....||      |:|..|.||:  |:|.|
 Frog   502 PVHDVTITTK-----------------SAASTPASRIACPGKIQMGPVRNLHHSGFSLSGSQEDD 549

  Fly   573 RSGVRACIKVKNPPGGKSS 591
            ....|...|:..||||:|:
 Frog   550 HVPRRTTQKIVAPPGGRSN 568

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CRMPNP_730954.2 D-HYD 22..475 CDD:238639 245/453 (54%)
PRK09060 24..483 CDD:181632 249/459 (54%)
dpysl4NP_001015765.1 PRK09060 17..469 CDD:181632 248/456 (54%)
D-HYD 17..466 CDD:238639 245/453 (54%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C61713247
eggNOG 1 0.900 E1_COG0044
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D174151at33208
OrthoFinder 1 1.000 FOG0000190
OrthoInspector 00.000 Not matched by this tool.
Phylome 1 0.910 0.846 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.750

Return to query results.
Submit another query.