DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CRMP and zgc:103559

Sequence 1:NP_730954.2 Gene:CRMP FlyBaseID:FBgn0023023 Length:594 Species:Drosophila melanogaster
Sequence 2:NP_001008599.1 Gene:zgc:103559 ZFINID:ZDB-GENE-041212-22 Length:459 Species:Danio rerio

Alignment Length:512 Identity:133/513 (26%)
Similarity:216/513 (42%) Gaps:91/513 (18%)


  Fly    24 IKNGEIVNHDKSFKADVYIEDGIIKFVGPSSEITIPGGVRTIDASGLMIIPGGIDPHTHMQLPFG 88
            :::..::..:|...|.:.|::|.|..|.|.||.:.....:.:|....:|:||.:|.|.|:..|  
Zfish    10 VRSQRVLCGEKILPAVIVIKEGKIHSVLPDSEASAHVAGKVLDVGDSLIMPGIVDSHVHVNEP-- 72

  Fly    89 GAVAVDDFYHGTKAAVAGGTTMIIDFVLPNKHESMIEAYDKWRSWADPKVCCDYG-LHVGITWWS 152
            |....:.::..|:||.|||.|.|.|..|     :.|......|:: :.|:|...| ..|...:|.
Zfish    73 GRTDWEGYWTATRAAAAGGITTIADMPL-----NTIPPTTTLRNF-NEKLCAATGQCFVDTAFWG 131

  Fly   153 KSV---SEEIGILCKELGVNSFKTFMAYKGLYQ---LNDSDLLDVFERIRHLNGVAMVHAENGDI 211
            ..:   ..|:..:| :.||..||.|:.:.|:.:   :.|:||....::::..|.|.:.|||    
Zfish   132 GVIPGNQMELKPMC-QAGVAGFKCFLIHSGVEEFPHVTDADLHAAMKQLQGTNSVLLFHAE---- 191

  Fly   212 IAKNTQRLLAEGINGPEGHEL---SRPEEVEAEAVHRA---CVLAHQADCPLYVVHVMSKSAGIE 270
              :.....:||. ..|:.:..   |||:.:|.||:|..   | |.:|..|  ::|| :|.:..:|
Zfish   192 --QELSHPVAEK-GDPQEYSTFLKSRPDIMELEAIHTVIEFC-LQYQVRC--HIVH-LSSAEPLE 249

  Fly   271 LARARHRYRGRYIMGET------LAA----ALGTDATCCQHLGFDAEAAHVLSPPLRPDKTTPEF 325
            |.||. :..|..:..||      |:|    ...|...||              ||:| .....|.
Zfish   250 LIRAA-KQAGAPLTVETTHHYLNLSAEDIPGRATQFKCC--------------PPIR-GTANQEL 298

  Fly   326 LMKLLANDDLQLTGSDNCTFNKEHKALGKGDFTKIPNGVNGVEDRMSLVWEKGVHAG--LLDPCR 388
            |...|...|:.:..||:.....:.|.|..||||:...|::.::..:||.|......|  ..|..|
Zfish   299 LWSALKAGDIDMVVSDHSPCTPDLKCLDSGDFTQAWGGISSLQFGLSLFWTSASKRGFSFSDAAR 363

  Fly   389 FVAVTSTNAAKIFNIYPQKGRIAVGSDADIVIWNPNATRTISKDTHHHACDFNIFEGMTVHGVCE 453
            .:........::.|   |||.:..|.|||:|||:|....|:.:|..||......:....:.|:..
Zfish   364 LLREEPARLCRLDN---QKGSLIPGHDADLVIWDPEKEFTVKEDNIHHKNKLTPYLDRVLRGMVR 425

  Fly   454 FVLVRGRICAERGNVRVAEGFGRFIPTPVRPPFVYDIIEGKVQSQPEEQHEEKQNGS 510
            |.:|||::                         ||.  .|...|||..:|...||.|
Zfish   426 FPIVRGQV-------------------------VYS--HGSFSSQPLGKHLLIQNKS 455

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CRMPNP_730954.2 D-HYD 22..475 CDD:238639 123/476 (26%)
PRK09060 24..483 CDD:181632 123/484 (25%)
zgc:103559NP_001008599.1 metallo-dependent_hydrolases 10..450 CDD:294200 130/506 (26%)
PRK09060 26..447 CDD:181632 127/487 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0044
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D719800at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.