DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CRMP and dpysl3

Sequence 1:NP_730954.2 Gene:CRMP FlyBaseID:FBgn0023023 Length:594 Species:Drosophila melanogaster
Sequence 2:XP_012814256.1 Gene:dpysl3 XenbaseID:XB-GENE-944729 Length:665 Species:Xenopus tropicalis

Alignment Length:595 Identity:292/596 (49%)
Similarity:394/596 (66%) Gaps:33/596 (6%)


  Fly     4 SPKPVKKVPIHL-QSAQNRVYIKNGEIVNHDKSFKADVYIEDGIIKFVGPSSEITIPGGVRTIDA 67
            |..|.|:...:| :...:|:.||.|.|||.|:||.||:|:|||:||.:|  ..:.:||||:||:|
 Frog    92 STTPGKEALQNLDEKESDRLLIKGGRIVNDDQSFYADIYMEDGLIKQIG--DNLIVPGGVKTIEA 154

  Fly    68 SGLMIIPGGIDPHTHMQLPFGGAVAVDDFYHGTKAAVAGGTTMIIDFVLPNKHESMIEAYDKWRS 132
            :|.|:||||||.|||:|:|:.|...||||:.|||||:|||||||:|.|:|....|:.||::|||.
 Frog   155 NGKMVIPGGIDVHTHLQMPYRGMTTVDDFFQGTKAALAGGTTMIVDHVIPEPEASLTEAFEKWRE 219

  Fly   133 WADPKVCCDYGLHVGITWWSKSVSEEIGILCKELGVNSFKTFMAYKGLYQLNDSDLLDVFERIRH 197
            |||.|.||||.|||.||.|:.||.:|:..|.|:.|||||..:||||.|||:::::|.:||..:..
 Frog   220 WADGKTCCDYSLHVDITHWNDSVKQEVEALVKQKGVNSFMVYMAYKDLYQMSNTELYEVFTFLGG 284

  Fly   198 LNGVAMVHAENGDIIAKNTQRLLAEGINGPEGHELSRPEEVEAEAVHRACVLAHQADCPLYVVHV 262
            |..:|.||||||||||:...|:|..||.|||||.||||||:|||||.||..:|.|.:|||||..|
 Frog   285 LGAIAQVHAENGDIIAQEQNRMLELGITGPEGHVLSRPEELEAEAVFRAITIASQTNCPLYVTKV 349

  Fly   263 MSKSAGIELARARHRYRGRYIMGETLAAALGTDATCCQHLGFDAEAAHVLSPPLRPDKTTPEFLM 327
            ||||:...:::||.  :|..:.||.:.|:||||.|......:...||.|.||||.||.|||:::.
 Frog   350 MSKSSVDLISQARK--KGYVVFGEPITASLGTDGTHYWSKNWAKAAAFVTSPPLSPDPTTPDYIN 412

  Fly   328 KLLANDDLQLTGSDNCTFNKEHKALGKGDFTKIPNGVNGVEDRMSLVWEKGVHAGLLDPCRFVAV 392
            .|||:.|||:|||.:.||:...||:||.:||.||.|.||:|:|||::|:|.|..|.:|..:||||
 Frog   413 SLLASGDLQVTGSAHATFSTAQKAIGKDNFTLIPEGTNGIEERMSVIWDKAVATGKMDENQFVAV 477

  Fly   393 TSTNAAKIFNIYPQKGRIAVGSDADIVIWNPNATRTISKDTHHHACDFNIFEGMTVHGVCEFVLV 457
            ||||||||||:||:|||||||||:|:|||:|:|.:.:|..:||.|.::||||||.:.|....|:.
 Frog   478 TSTNAAKIFNLYPRKGRIAVGSDSDLVIWDPDAVKIVSAKSHHSAAEYNIFEGMELRGAPLVVIC 542

  Fly   458 RGRICAERGNVRVAEGFGRFIPTPVRPPFVYDIIEGKVQSQPEEQHEEKQ---NGSMAKRFAELD 519
            :|:|..|.|.:.|.:|.|||||....|.:||..|  |.:::..|.|...:   :|          
 Frog   543 QGKIMMEDGTLHVTQGTGRFIPCSPFPDYVYKRI--KARTKMAELHAVPRGMYDG---------- 595

  Fly   520 IQIPVQEPISAMLAGNLAMPAEGS-LCSTPSVRGRVDGKRDLQESSFSIS-EELDRSGVR-ACIK 581
               ||.:..|...||..|...:|| ...||.|       |:|..|.||:: .:.|.|||| |..:
 Frog   596 ---PVYDLASTPKAGTPAGSTKGSPTKQTPPV-------RNLHHSGFSLAGNQGDESGVRSASRR 650

  Fly   582 VKNPPGGKSS 591
            :..||||:|:
 Frog   651 IVAPPGGRSN 660

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CRMPNP_730954.2 D-HYD 22..475 CDD:238639 247/453 (55%)
PRK09060 24..483 CDD:181632 252/459 (55%)
dpysl3XP_012814256.1 PRK09060 111..561 CDD:181632 248/454 (55%)
D-HYD 111..560 CDD:238639 247/453 (55%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C61712497
eggNOG 1 0.900 E1_COG0044
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 594 1.000 Inparanoid score I881
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D174151at33208
OrthoFinder 1 1.000 FOG0000190
OrthoInspector 1 1.000 T601220
Phylome 1 0.910 0.846 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R5547
TreeFam 00.000 Not matched by this tool.
98.830

Return to query results.
Submit another query.