DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CRMP and CG6106

Sequence 1:NP_730954.2 Gene:CRMP FlyBaseID:FBgn0023023 Length:594 Species:Drosophila melanogaster
Sequence 2:NP_001285403.1 Gene:CG6106 FlyBaseID:FBgn0030914 Length:486 Species:Drosophila melanogaster

Alignment Length:512 Identity:126/513 (25%)
Similarity:197/513 (38%) Gaps:103/513 (20%)


  Fly    13 IHLQSAQNRVYIKNGEIVNHDKSFKADVYIEDGIIKFVGPSSEITIPGGVRT----------IDA 67
            |.|........|..|.||:           .:|||:.|     :..|..|.|          .|.
  Fly    10 IFLGDGSQNALIHGGIIVD-----------TEGIIRRV-----LRSPQEVNTYLYNTESESVYDF 58

  Fly    68 SGLMIIPGGIDPHTHMQLPFGGAVAVDDFYHGTKAAVAGGTTMIIDFVLPNKHESMIEAYDKWR- 131
            ..|:::||.|||:.|:..|  |....:.|...||||.|||.|.|||.....:..::..|:.|.: 
  Fly    59 GDLVLMPGLIDPNVHINEP--GRKDWEGFATATKAAAAGGFTTIIDRPTNAQPPTVSVAHLKAKT 121

  Fly   132 SWADPKVCCDYGLHVGITWWSKSVSEEIGILCKELGVNSF--------------KTFMAYKGLYQ 182
            |.|..|:..|.|      :|...|......|...||....              :.|.|      
  Fly   122 STARGKIYVDVG------FWGGLVPGNGDQLAALLGAGVMGLQCTLCDPAAPVSQEFPA------ 174

  Fly   183 LNDSDLLDVFERIRHLNGVAMVHAENGDIIAKNTQRLLAEGINGPEGHE-------LSRPEEVEA 240
            :|:|.|.:.      |:.:....||...|:|.:.:..|...|:..|...       ::||.::|.
  Fly   175 VNESQLEEA------LSQLDKDQAEGEAIVAVHAELPLTTEIHPDEEAPREYGTFLVTRPPQMEI 233

  Fly   241 EAVHRACVLAHQADCPLYVVHVMSKSAGIELARARHRYRGRYIMGETLAAALGTDATCCQHLGFD 305
            .|....|.||::.  |...:|:::.|:|..|.......|    .|..|     |..||..:|...
  Fly   234 SATQLLCRLANRH--PRRCIHILNCSSGESLPLVEECRR----QGGNL-----TVDTCPHYLALA 287

  Fly   306 AE------AAHVLSPPLRPDKTTPEFLMKLLANDDLQLTGSDNCTFNKEHKAL----GKGDFTKI 360
            ||      ......||:|..:...:....|.....:::.|||:.......:||    |:|:|.|.
  Fly   288 AEDVPDCGTEFKTWPPIRERRNQEQLWQALRPGGAIRMIGSDHSPATPGARALTCGRGRGNFLKA 352

  Fly   361 PNGVNGVEDRMSLVW-----EKG-VHAGLLDPCRFVAVTSTNAAKIFNIYPQKGRIAVGSDADIV 419
            ..|:|.::..:|:||     .:| .:..:.|..|.:.   ...|.:..:...|||||.|.|||..
  Fly   353 WPGINSLQLSLSVVWTAAANRRGSANLTIADIHRLMC---QEPANLCGLSASKGRIAEGYDADFC 414

  Fly   420 IWNPNATRTISKDTHHHACDFNIFEGMTVHGVCEFVLVRGRICAERGNVRVAEGFGR 476
            :|:|....|:..:..:.|.....:.|..:.||....:|||....::     .||||:
  Fly   415 VWSPEEEFTVGPELLYTATKATPYAGQKLRGVVHATVVRGLHVYQQ-----FEGFGQ 466

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CRMPNP_730954.2 D-HYD 22..475 CDD:238639 123/501 (25%)
PRK09060 24..483 CDD:181632 124/502 (25%)
CG6106NP_001285403.1 L-HYD_ALN 2..473 CDD:238640 126/513 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C61788633
eggNOG 1 0.900 E1_COG0044
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 0.917438 Normalized mean entropy S1869
OrthoDB 1 1.010 D719800at2759
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
43.790

Return to query results.
Submit another query.