DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CRMP and dpysl5a

Sequence 1:NP_730954.2 Gene:CRMP FlyBaseID:FBgn0023023 Length:594 Species:Drosophila melanogaster
Sequence 2:NP_001018159.1 Gene:dpysl5a ZFINID:ZDB-GENE-030131-3136 Length:564 Species:Danio rerio

Alignment Length:582 Identity:269/583 (46%)
Similarity:367/583 (63%) Gaps:26/583 (4%)


  Fly    17 SAQNRVYIKNGEIVNHDKSFKADVYIEDGIIKFVGPSSEITIPGGVRTIDASGLMIIPGGIDPHT 81
            ||..|:.||.|::||.|.:.:||||||:|||:.||  .|:.||||.:.|||:|.:::|||||...
Zfish     5 SATVRILIKGGKVVNDDFTQEADVYIENGIIQQVG--KELMIPGGAKVIDATGKLVLPGGIDTSV 67

  Fly    82 HMQLPFGGAVAVDDFYHGTKAAVAGGTTMIIDFVLPNKHESMIEAYDKWRSWADPKVCCDYGLHV 146
            |:...|......||||.|||||:||||||:|..|||.|:||:::||:|.||.||.|.||||.||:
Zfish    68 HLNESFMNGTTADDFYSGTKAALAGGTTMVIGHVLPEKNESLLDAYEKARSHADAKACCDYALHM 132

  Fly   147 GITWWSKSVSEEIGILCKELGVNSFKTFMAYKGLYQLNDSDLLDVFERIRHLNGVAMVHAENGDI 211
            |:|||......::..|.::.|||||:.:||||.:|.|.||:|....:..:.:..||.||||||::
Zfish   133 GVTWWGPKARAQMETLVRDKGVNSFQMYMAYKDMYMLRDSELFQALQNCKDIGAVARVHAENGEL 197

  Fly   212 IAKNTQRLLAEGINGPEGHELSRPEEVEAEAVHRACVLAHQADCPLYVVHVMSKSAGIELARARH 276
            :|:..:..|..||:||||.|:|||||:||||||||..:|::|.||:|:|:|.|.|||..||.|  
Zfish   198 VAEGAREALDLGISGPEGIEISRPEELEAEAVHRAITIANRAHCPIYLVNVSSMSAGDVLASA-- 260

  Fly   277 RYRGRYIMGETLAAALGTDATCCQHLGFDAEAAHVLSPPLRPDKTTPEFLMKLLANDDLQLTGSD 341
            :.:|:.:.|||..|....:.....|..:...||.|..||||.|..||.:|:.||.||.|.:..||
Zfish   261 KMQGKVVHGETTTAHAVLNGMQYYHQDWAHAAAFVTVPPLRLDPNTPNYLLSLLGNDTLNVVTSD 325

  Fly   342 NCTFNKEHKALGKGDFTKIPNGVNGVEDRMSLVWEKGVHAGLLDPCRFVAVTSTNAAKIFNIYPQ 406
            :..|..:.||:||.||||||:||.||:||||::||:||..|.:|..|||||||:|||||:|:||:
Zfish   326 HRPFTTKQKAMGKDDFTKIPHGVPGVQDRMSVMWERGVVGGKMDENRFVAVTSSNAAKIYNLYPR 390

  Fly   407 KGRIAVGSDADIVIWNPNATRTISKDTHHHACDFNIFEGMTVHGVCEFVLVRGRICAERGNVRVA 471
            ||||..|:|||:|:|:|.:|||||..|.....|.|::|.:..|||....:.|||:..|.|....|
Zfish   391 KGRIIPGADADVVVWDPESTRTISVTTQWQGGDVNLYENLRCHGVPLVTISRGRVVYENGIFTCA 455

  Fly   472 EGFGRFIPTPVRPPFVYDIIEGKVQSQPEEQHEEKQNGSMAKRFAELDIQIPVQEPISAML-AGN 535
            ||.|:|.|....|.::|     |...|.|:        ..|.:..|   :.|....::|:. :|.
Zfish   456 EGSGKFYPLRTFPDYLY-----KKMVQREK--------CQALKGVE---RTPYTGDVAAVQNSGK 504

  Fly   536 LAM-PAEGSLCSTPSVRGRVDGKRDLQESSFSIS--EELDRSGVRACIKVKNPPGGKSSGFW 594
            ..: ||:|.:...|..|.  .|.|||.|||||:|  :..|....||..::..||||:|||.|
Zfish   505 KDLGPADGDMNPRPCTRH--GGVRDLHESSFSLSGAQIDDNVPKRASARILAPPGGRSSGIW 564

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CRMPNP_730954.2 D-HYD 22..475 CDD:238639 227/453 (50%)
PRK09060 24..483 CDD:181632 230/459 (50%)
dpysl5aNP_001018159.1 D-HYD 10..459 CDD:238639 227/453 (50%)
PRK09060 11..450 CDD:181632 223/443 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C61693980
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D174151at33208
OrthoFinder 1 1.000 FOG0000190
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR11647
Phylome 1 0.910 0.846 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
54.950

Return to query results.
Submit another query.