DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CRMP and Dpysl4

Sequence 1:NP_730954.2 Gene:CRMP FlyBaseID:FBgn0023023 Length:594 Species:Drosophila melanogaster
Sequence 2:NP_036123.3 Gene:Dpysl4 MGIID:1349764 Length:572 Species:Mus musculus

Alignment Length:597 Identity:285/598 (48%)
Similarity:370/598 (62%) Gaps:50/598 (8%)


  Fly     9 KKVPIHLQSAQNRVYIKNGEIVNHDKSFKADVYIEDGIIKFVGPSSEITIPGGVRTIDASGLMII 73
            |.:|   :...:|:.||.|:|||.|:||.||:|:|||:||.:|  ..:.:|||::||||.|||::
Mouse     7 KSIP---RITSDRLLIKGGKIVNDDQSFHADLYVEDGLIKQIG--ENLIVPGGIKTIDAHGLMVL 66

  Fly    74 PGGIDPHTHMQLPFGGAVAVDDFYHGTKAAVAGGTTMIIDFVLPNKHESMIEAYDKWRSWADPKV 138
            |||:|.||.:|:|..|....|||..|||||:|||||||:|.|.|:...|::.||::||..||...
Mouse    67 PGGVDVHTRLQMPVMGMTPADDFCQGTKAALAGGTTMILDHVFPDAGVSLLAAYEQWRERADSAA 131

  Fly   139 CCDYGLHVGITWWSKSVSEEIGILCKELGVNSFKTFMAYKGLYQLNDSDLLDVFERIRHLNGVAM 203
            ||||.|||.|..|.:|..||:..|.::.|||||..|||||...|..|..:.::|..||.|..||.
Mouse   132 CCDYSLHVDIPRWHESTKEELEALVRDKGVNSFLVFMAYKDRCQCTDGQIYEIFSLIRDLGAVAQ 196

  Fly   204 VHAENGDIIAKNTQRLLAEGINGPEGHELSRPEEVEAEAVHRACVLAHQADCPLYVVHVMSKSAG 268
            ||||||||:.:..:|||.:||.|||||.||.|||||||||:||..:|.||:|||||..||||.|.
Mouse   197 VHAENGDIVEEEQKRLLEQGITGPEGHVLSHPEEVEAEAVYRAVTIAKQANCPLYVTKVMSKGAA 261

  Fly   269 IELARARHRYRGRYIMGETLAAALGTDATCCQHLGFDAEAAHVLSPPLRPDKTTPEFLMKLLAND 333
            ..:|:|:.  ||..:.||.:.|:||||.:......:...||.|.|||:.||.||.:.|..||::.
Mouse   262 DMVAQAKR--RGVVVFGEPITASLGTDGSHYWSKNWAKAAAFVTSPPINPDPTTADHLTSLLSSG 324

  Fly   334 DLQLTGSDNCTFNKEHKALGKGDFTKIPNGVNGVEDRMSLVWEKGVHAGLLDPCRFVAVTSTNAA 398
            |||:|||.:|||....||:||.:||.||.||||:|:|||:||||.|.:|.:|...||||||||||
Mouse   325 DLQVTGSAHCTFTTAQKAVGKDNFTLIPEGVNGIEERMSVVWEKCVASGKMDENEFVAVTSTNAA 389

  Fly   399 KIFNIYPQKGRIAVGSDADIVIWNPNATRTISKDTHHHACDFNIFEGMTVHGVCEFVLVRGRICA 463
            ||||.||:|||:|||||||:|||||.||:.||..:|:...::|||||:...||...|:.:||:..
Mouse   390 KIFNFYPRKGRVAVGSDADLVIWNPRATKVISAKSHNLNVEYNIFEGVECRGVPTVVISQGRVVL 454

  Fly   464 ERGNVRVAEGFGRFIPTPVRPPFVYDIIEGKVQSQPEEQHEEKQNGSMAKRFAELD------IQI 522
            |.||:.|..|.|||||....|.|||..|:.:                  .|.||:.      ...
Mouse   455 EDGNLLVTPGAGRFIPRKTFPDFVYKRIKAR------------------NRLAEIHGVPRGLYDG 501

  Fly   523 PVQEPISAMLAGNLAMPAEGSLCSTPSVRGRVDGK------RDLQESSFSI--SEELDRSGVRAC 579
            ||.|   .||.   |.|..|:     ..|....||      |:|.:|.||:  |:..|....|..
Mouse   502 PVHE---VMLP---AKPGSGT-----QARASCSGKISVPPVRNLHQSGFSLSGSQADDHIARRTA 555

  Fly   580 IKVKNPPGGKSS 591
            .|:..||||:|:
Mouse   556 QKIMAPPGGRSN 567

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CRMPNP_730954.2 D-HYD 22..475 CDD:238639 244/453 (54%)
PRK09060 24..483 CDD:181632 249/459 (54%)
Dpysl4NP_036123.3 D-HYD 17..466 CDD:238639 244/453 (54%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C61686949
eggNOG 1 0.900 E1_COG0044
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 563 1.000 Inparanoid score I1068
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D174151at33208
OrthoFinder 1 1.000 FOG0000190
OrthoInspector 1 1.000 T616160
orthoMCL 1 0.900 OOG5_127801
Panther 1 1.100 O PTHR11647
Phylome 1 0.910 0.846 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
109.800

Return to query results.
Submit another query.