DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CRMP and ure2

Sequence 1:NP_730954.2 Gene:CRMP FlyBaseID:FBgn0023023 Length:594 Species:Drosophila melanogaster
Sequence 2:NP_594813.1 Gene:ure2 PomBaseID:SPAC1952.11c Length:835 Species:Schizosaccharomyces pombe

Alignment Length:460 Identity:91/461 (20%)
Similarity:153/461 (33%) Gaps:151/461 (33%)


  Fly    24 IKNGEIVNHDKSFKADVYIEDGIIKFVGPS----------SEITIPGGVRTIDASGLMIIPGGID 78
            |.|..|::|...:|||:.|::|.|..:|.:          ..:.|......|.|...::..||:|
pombe   338 ITNAVIIDHTGIYKADIGIKNGYIVGIGKAGNPDTMDNIGENMVIGSSTDVISAENKIVTYGGMD 402

  Fly    79 PHTH----MQLPFGGAVAVDDFYHGTKAAVAG--GTTMIIDFVLPNKH--ESMIEAYDKWRSWAD 135
            .|.|    .|:....|..:...|.|......|  .||     ..|||.  .||:.:.|       
pombe   403 SHVHFICPQQIEEALASGITTMYGGGTGPSTGTNATT-----CTPNKDLIRSMLRSTD------- 455

  Fly   136 PKVCCDYGLHVGITW-----WSKSVSEEIGILCKELGVN--------SFKTFMAYKGLYQ----- 182
                 .|.:::|:|.     .|.|:.|:|...|..|.::        :..:.::....|.     
pombe   456 -----SYPMNIGLTGKGNDSGSSSLKEQIEAGCSGLKLHEDWGSTPAAIDSCLSVCDEYDVQCLI 515

  Fly   183 ----LNDSDLLD-VFERIR-------HLNGVAMVHAENGDIIAKNTQRLLAEGINGPEGHELSRP 235
                ||:|..:: .|:..:       |:.|....||.:...:.:|...|       |.....:||
pombe   516 HTDTLNESSFVEGTFKAFKNRTIHTYHVEGAGGGHAPDIISLVQNPNIL-------PSSTNPTRP 573

  Fly   236 -------EEVEAEAVHRACVLAHQADCPLYVVHVMSKSAGIELARARHRYRGRYIMGETLAAALG 293
                   ||::.                |.|.|.:|::...::|.|..|.|...|..|.:...||
pombe   574 FTTNTLDEELDM----------------LMVCHHLSRNVPEDVAFAESRIRAETIAAEDILQDLG 622

  Fly   294 TDATCCQHLGFDAEAAHVLSPPLRPDKTTPEFLMKLLANDDLQLTGSDNC------TFNKEHKAL 352
            ..:                                 :.:.|.|..|  .|      |:...||  
pombe   623 AIS---------------------------------MISSDSQAMG--RCGEVISRTWKTAHK-- 650

  Fly   353 GKGDFTKIPNGVNGVEDRMSLVWEKGVHAGLLDPCRFVAVTSTNAAKIFNIYPQKGRIAVGSDAD 417
                 .|:..|        :|..::|.........|:|:..:.|.|....|....|.:.:|..||
pombe   651 -----NKLQRG--------ALPEDEGSGVDNFRVKRYVSKYTINPAITHGISHIVGSVEIGKFAD 702

  Fly   418 IVIWN 422
            :|:|:
pombe   703 LVLWD 707

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CRMPNP_730954.2 D-HYD 22..475 CDD:238639 91/461 (20%)
PRK09060 24..483 CDD:181632 91/461 (20%)
ure2NP_594813.1 Urease_gamma 1..98 CDD:278946
PLN02303 3..835 CDD:215172 91/461 (20%)
UreB 134..239 CDD:223902
Urease_alpha 271..834 CDD:238221 91/461 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000190
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.