DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CRMP and Dpysl3

Sequence 1:NP_730954.2 Gene:CRMP FlyBaseID:FBgn0023023 Length:594 Species:Drosophila melanogaster
Sequence 2:XP_006254732.1 Gene:Dpysl3 RGDID:2410 Length:683 Species:Rattus norvegicus

Alignment Length:610 Identity:291/611 (48%)
Similarity:386/611 (63%) Gaps:54/611 (9%)


  Fly     4 SPKPVKKVPIHLQSA------QN--------RVYIKNGEIVNHDKSFKADVYIEDGIIKFVGPSS 54
            ||||   ..:.::||      ||        |:.||.|.|||.|:||.||:|:|||:||.:|  .
  Rat   101 SPKP---AGVEIRSATGKEVLQNLGPKDKSDRLLIKGGRIVNDDQSFYADIYMEDGLIKQIG--D 160

  Fly    55 EITIPGGVRTIDASGLMIIPGGIDPHTHMQLPFGGAVAVDDFYHGTKAAVAGGTTMIIDFVLPNK 119
            .:.:||||:||:|:|.|::|||||.|||.|:|:.|...||||:.|||||:|||||||||.|:|..
  Rat   161 NLIVPGGVKTIEANGKMVMPGGIDVHTHFQMPYKGMTTVDDFFQGTKAALAGGTTMIIDHVVPEP 225

  Fly   120 HESMIEAYDKWRSWADPKVCCDYGLHVGITWWSKSVSEEIGILCKELGVNSFKTFMAYKGLYQLN 184
            ..|:.|||:|||.|||.|.||||.|||.||.|:.||.:|:..|.||.|||||..:||||.|||::
  Rat   226 ESSLTEAYEKWREWADGKSCCDYALHVDITHWNDSVKQEVQNLSKEKGVNSFMVYMAYKDLYQVS 290

  Fly   185 DSDLLDVFERIRHLNGVAMVHAENGDIIAKNTQRLLAEGINGPEGHELSRPEEVEAEAVHRACVL 249
            :::|.::|..:..|..:|.||||||||||:...|:|..||.|||||.||||||:|||||.||..:
  Rat   291 NTELYEIFTCLGELGAIAQVHAENGDIIAQEQARMLEMGITGPEGHVLSRPEELEAEAVFRAITV 355

  Fly   250 AHQADCPLYVVHVMSKSAGIELARARHRYRGRYIMGETLAAALGTDATCCQHLGFDAEAAHVLSP 314
            |.|.:|||||..||||||...:::||.  :|..:.||.:.|:||.|.|......:...||.|.||
  Rat   356 ASQTNCPLYVTKVMSKSAADLISQARK--KGNVVFGEPITASLGIDGTHYWSKNWAKAAAFVTSP 418

  Fly   315 PLRPDKTTPEFLMKLLANDDLQLTGSDNCTFNKEHKALGKGDFTKIPNGVNGVEDRMSLVWEKGV 379
            ||.||.|||:::..|||:.||||:||.:|||:...||:||.:||.||.|.||||:|||::|:|.|
  Rat   419 PLSPDPTTPDYINSLLASGDLQLSGSAHCTFSTAQKAIGKDNFTAIPEGTNGVEERMSVIWDKAV 483

  Fly   380 HAGLLDPCRFVAVTSTNAAKIFNIYPQKGRIAVGSDADIVIWNPNATRTISKDTHHHACDFNIFE 444
            ..|.:|..:||||||||||||||:||:|||||||||:|:|||:|:|.:.:|...|....::||||
  Rat   484 ATGKMDENQFVAVTSTNAAKIFNLYPRKGRIAVGSDSDLVIWDPDAVKIVSAKNHQSVAEYNIFE 548

  Fly   445 GMTVHGVCEFVLVRGRICAERGNVRVAEGFGRFIPTPVRPPFVYDIIEGKVQSQPEEQHEEKQNG 509
            ||.:.|....|:.:|:|..|.||:.|.:|.|||||......:||..|:.:               
  Rat   549 GMELRGAPLVVICQGKIMLEDGNLHVTQGAGRFIPCSPFSDYVYKRIKAR--------------- 598

  Fly   510 SMAKRFAELD------IQIPVQEPISAMLAGNLAMPAEGS-LCSTPSVRGRVDGKRDLQESSFSI 567
               ::.|:|.      ...||.:..:....|..|....|| ....|.|       |:|.:|.||:
  Rat   599 ---RKMADLHAVPRGMYDGPVFDLTTTPKGGTPAGSTRGSPTRPNPPV-------RNLHQSGFSL 653

  Fly   568 SEELDRSGVRACIK-VKNPPGGKSS 591
            |......|||:..| :..||||:|:
  Rat   654 SGTQVDEGVRSASKRIVAPPGGRSN 678

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CRMPNP_730954.2 D-HYD 22..475 CDD:238639 249/453 (55%)
PRK09060 24..483 CDD:181632 254/459 (55%)
Dpysl3XP_006254732.1 D-hydantoinase 130..584 CDD:273937 254/458 (55%)
PRK09060 130..580 CDD:181632 250/454 (55%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C61709150
eggNOG 1 0.900 E1_COG0044
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 567 1.000 Inparanoid score I1013
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D174151at33208
OrthoFinder 1 1.000 FOG0000190
OrthoInspector 1 1.000 T618283
orthoMCL 1 0.900 OOG5_127801
Panther 1 1.100 O PTHR11647
Phylome 1 0.910 0.846 Consistency score
TreeFam 00.000 Not matched by this tool.
109.800

Return to query results.
Submit another query.