DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CRMP and Dpysl4

Sequence 1:NP_730954.2 Gene:CRMP FlyBaseID:FBgn0023023 Length:594 Species:Drosophila melanogaster
Sequence 2:NP_037065.1 Gene:Dpysl4 RGDID:2409 Length:572 Species:Rattus norvegicus

Alignment Length:597 Identity:282/598 (47%)
Similarity:370/598 (62%) Gaps:50/598 (8%)


  Fly     9 KKVPIHLQSAQNRVYIKNGEIVNHDKSFKADVYIEDGIIKFVGPSSEITIPGGVRTIDASGLMII 73
            |.:|   :...:|:.||.|:|||.|:||.||:|:|||:||.:|  ..:.:|||::||||.|||::
  Rat     7 KSIP---RITSDRLLIKGGKIVNDDQSFHADLYVEDGLIKQIG--ENLIVPGGIKTIDAHGLMVL 66

  Fly    74 PGGIDPHTHMQLPFGGAVAVDDFYHGTKAAVAGGTTMIIDFVLPNKHESMIEAYDKWRSWADPKV 138
            |||:|.||.:|:|..|....|||..|||||:|||||||:|.|.|:...|::.||::||..||...
  Rat    67 PGGVDVHTRLQMPVLGMTPADDFCQGTKAALAGGTTMILDHVFPDAGVSLLAAYEQWRERADSAA 131

  Fly   139 CCDYGLHVGITWWSKSVSEEIGILCKELGVNSFKTFMAYKGLYQLNDSDLLDVFERIRHLNGVAM 203
            ||||.|||.|..|.:|..||:..|.::.|||||..|||||...|..|..:.::|..||.|..||.
  Rat   132 CCDYSLHVDIPRWHESTKEELEALVRDKGVNSFLVFMAYKDRCQCTDGQIYEIFSLIRDLGAVAQ 196

  Fly   204 VHAENGDIIAKNTQRLLAEGINGPEGHELSRPEEVEAEAVHRACVLAHQADCPLYVVHVMSKSAG 268
            ||||||||:.:..:|||.:||.|||||.||.|||||||||:||..:|.||:||||:..||||.|.
  Rat   197 VHAENGDIVEEEQKRLLEQGITGPEGHVLSHPEEVEAEAVYRAVTIAKQANCPLYITKVMSKGAA 261

  Fly   269 IELARARHRYRGRYIMGETLAAALGTDATCCQHLGFDAEAAHVLSPPLRPDKTTPEFLMKLLAND 333
            ..:|:|:.  ||..:.||.:.|:||||.:......:...||.|.|||:.||.||.:.|..||::.
  Rat   262 DMVAQAKR--RGVVVFGEPITASLGTDGSHYWSKNWAKAAAFVTSPPINPDPTTADHLTSLLSSG 324

  Fly   334 DLQLTGSDNCTFNKEHKALGKGDFTKIPNGVNGVEDRMSLVWEKGVHAGLLDPCRFVAVTSTNAA 398
            |||:|||.:|||....||:||.:||.||.|:||:|:|||:||||.|.:|.:|...||||||||||
  Rat   325 DLQVTGSAHCTFTTAQKAVGKDNFTLIPEGINGIEERMSVVWEKCVASGKMDENEFVAVTSTNAA 389

  Fly   399 KIFNIYPQKGRIAVGSDADIVIWNPNATRTISKDTHHHACDFNIFEGMTVHGVCEFVLVRGRICA 463
            ||||.||:|||:|||||||:|||||.||:.||..:|:...::|||||:...|:...|:.:||:..
  Rat   390 KIFNFYPRKGRVAVGSDADLVIWNPRATKVISAKSHNLNVEYNIFEGVECRGMPTVVISQGRVVL 454

  Fly   464 ERGNVRVAEGFGRFIPTPVRPPFVYDIIEGKVQSQPEEQHEEKQNGSMAKRFAELD------IQI 522
            |.||:.|..|.|||||....|.|||..|:.:                  .|.||:.      ...
  Rat   455 EDGNLLVTPGAGRFIPRKTFPDFVYKRIKAR------------------NRLAEIHGVPRGLYDG 501

  Fly   523 PVQEPISAMLAGNLAMPAEGSLCSTPSVRGRVDGK------RDLQESSFSI--SEELDRSGVRAC 579
            ||.|   .||.   |.|..|:     ..|....||      |:|.:|.||:  |:..|....|..
  Rat   502 PVHE---VMLP---AKPGSGT-----QARASCPGKISVPPVRNLHQSGFSLSGSQADDHIARRTA 555

  Fly   580 IKVKNPPGGKSS 591
            .|:..||||:|:
  Rat   556 QKIMAPPGGRSN 567

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CRMPNP_730954.2 D-HYD 22..475 CDD:238639 241/453 (53%)
PRK09060 24..483 CDD:181632 246/459 (54%)
Dpysl4NP_037065.1 PRK09060 17..467 CDD:181632 242/454 (53%)
D-HYD 17..466 CDD:238639 241/453 (53%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C61699305
eggNOG 1 0.900 E1_COG0044
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 567 1.000 Inparanoid score I1013
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D174151at33208
OrthoFinder 1 1.000 FOG0000190
OrthoInspector 1 1.000 T618283
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR11647
Phylome 1 0.910 0.846 Consistency score
TreeFam 00.000 Not matched by this tool.
98.900

Return to query results.
Submit another query.