DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CRMP and Crmp1

Sequence 1:NP_730954.2 Gene:CRMP FlyBaseID:FBgn0023023 Length:594 Species:Drosophila melanogaster
Sequence 2:NP_001352080.1 Gene:Crmp1 RGDID:2407 Length:686 Species:Rattus norvegicus

Alignment Length:595 Identity:277/596 (46%)
Similarity:395/596 (66%) Gaps:35/596 (6%)


  Fly     5 PKPVKKVPIHLQSAQ-NRVYIKNGEIVNHDKSFKADVYIEDGIIKFVGPSSEITIPGGVRTIDAS 68
            |.| :.:|:...:.| :|:.|:.|.|:|.|:||.||||:|||:||.:|  ..:.:||||:||:|:
  Rat   114 PAP-RDLPLGRDNGQSDRLLIRGGRIINDDQSFYADVYLEDGLIKQIG--ENLIVPGGVKTIEAN 175

  Fly    69 GLMIIPGGIDPHTHMQLPFGGAVAVDDFYHGTKAAVAGGTTMIIDFVLPNKHESMIEAYDKWRSW 133
            |.|:||||||.:|::|.|..|..:.|||:.||:||:|||||||||.|:|....|::.:::||...
  Rat   176 GRMVIPGGIDVNTYLQKPSQGMTSADDFFQGTRAALAGGTTMIIDHVVPEPGSSLLTSFEKWHEA 240

  Fly   134 ADPKVCCDYGLHVGITWWSKSVSEEIGILCKELGVNSFKTFMAYKGLYQLNDSDLLDVFERIRHL 198
            ||.|.||||.|||.||.|...|.||:.:|.::.|||||:.:||||.|||::||.|.:.|..::.|
  Rat   241 ADTKSCCDYSLHVDITSWYDGVREELEVLVQDKGVNSFQVYMAYKDLYQMSDSQLYEAFTFLKGL 305

  Fly   199 NGVAMVHAENGDIIAKNTQRLLAEGINGPEGHELSRPEEVEAEAVHRACVLAHQADCPLYVVHVM 263
            ..|.:|||||||:||:..:|:|..||.|||||.||||||:|||||.||..:|.:.:||:|:..||
  Rat   306 GAVILVHAENGDLIAQEQKRILEMGITGPEGHALSRPEELEAEAVFRAIAIAGRINCPVYITKVM 370

  Fly   264 SKSAGIELARARHRYRGRYIMGETLAAALGTDATCCQHLGFDAEAAHVLSPPLRPDKTTPEFLMK 328
            ||||...:|.||.  :|..:.||.:||:||||.|......:...||.|.||||.||.|||::|..
  Rat   371 SKSAADIIALARK--KGPLVFGEPIAASLGTDGTHYWSKNWAKAAAFVTSPPLSPDPTTPDYLTS 433

  Fly   329 LLANDDLQLTGSDNCTFNKEHKALGKGDFTKIPNGVNGVEDRMSLVWEKGVHAGLLDPCRFVAVT 393
            |||..|||:|||.:|.::...||:||.:||.||.||||:|:||::||:|.|..|.:|..:|||||
  Rat   434 LLACGDLQVTGSGHCPYSTAQKAVGKDNFTLIPEGVNGIEERMTVVWDKAVATGKMDENQFVAVT 498

  Fly   394 STNAAKIFNIYPQKGRIAVGSDADIVIWNPNATRTISKDTHHHACDFNIFEGMTVHGVCEFVLVR 458
            |||||||||:||:|||||||||||:|||:|:..:|::..:|....::||||||..||....|:.:
  Rat   499 STNAAKIFNLYPRKGRIAVGSDADVVIWDPDKMKTLTAKSHKSTVEYNIFEGMECHGSPLVVISQ 563

  Fly   459 GRICAERGNVRVAEGFGRFIPTPVRPPFVYDIIEGKVQSQPEEQHEEKQNGSMAKRFAELDI-QI 522
            |:|..|.||:.|::|.|||||....|..:|..:  :::|:....|      |:::...:..: ::
  Rat   564 GKIVFEDGNISVSKGMGRFIPRKPFPEHLYQRV--RIRSKVFGLH------SVSRGMYDGPVYEV 620

  Fly   523 PVQEPISAMLAGNLAMPAEGSLCSTPSVRGRVDGKRDLQESSFSIS-EELD-----RSGVRACIK 581
            |.....:|        ||. |..|:|| :.:....|:|.:|:||:| .::|     |:|.|    
  Rat   621 PATPKHAA--------PAP-SAKSSPS-KHQPPPIRNLHQSNFSLSGAQIDDNNPRRTGHR---- 671

  Fly   582 VKNPPGGKSS 591
            :..||||:|:
  Rat   672 IVAPPGGRSN 681

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CRMPNP_730954.2 D-HYD 22..475 CDD:238639 239/453 (53%)
PRK09060 24..483 CDD:181632 244/459 (53%)
Crmp1NP_001352080.1 D-HYD 131..580 CDD:238639 239/453 (53%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C61706561
eggNOG 1 0.900 E1_COG0044
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 567 1.000 Inparanoid score I1013
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D174151at33208
OrthoFinder 1 1.000 FOG0000190
OrthoInspector 1 1.000 T618283
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR11647
Phylome 1 0.910 0.846 Consistency score
TreeFam 00.000 Not matched by this tool.
98.900

Return to query results.
Submit another query.