DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CRMP and FLT3

Sequence 1:NP_730954.2 Gene:CRMP FlyBaseID:FBgn0023023 Length:594 Species:Drosophila melanogaster
Sequence 2:NP_004110.2 Gene:FLT3 HGNCID:3765 Length:993 Species:Homo sapiens

Alignment Length:449 Identity:90/450 (20%)
Similarity:144/450 (32%) Gaps:178/450 (40%)


  Fly    16 QSAQNRVYIKNGE---------IVNH---------DKSFKADVYIEDGIIKFVGPSSEITIPGGV 62
            |:...::::|.||         .|||         :|:.:...|.|                  :
Human   254 QTTLPQLFLKVGEPLWIRCKAVHVNHGFGLTWELENKALEEGNYFE------------------M 300

  Fly    63 RTIDASGLMIIPGGIDPHTHMQLPFGGAVAVDD--FY------HGTKAAVAGGTTMIIDFV-LPN 118
            .|...:..||         .:...|..:||.:|  :|      |.:::|:.  |.:...|: ..|
Human   301 STYSTNRTMI---------RILFAFVSSVARNDTGYYTCSSSKHPSQSALV--TIVEKGFINATN 354

  Fly   119 KHESM-IEAYDKW----RSWADPKVCCDYGLHVGITWWSKSVSEEIGILCKELGVN---SFKTFM 175
            ..|.. |:.|:::    |..|.|::.|        ||.....|    ..|::.|::   |...|.
Human   355 SSEDYEIDQYEEFCFSVRFKAYPQIRC--------TWTFSRKS----FPCEQKGLDNGYSISKFC 407

  Fly   176 AYKGLYQLNDSDLLDVFERIRHLNGVAMVHAENGDIIAKNTQRLLAEGINGPEGHELSRPEEVEA 240
            .:|                  |..|..:.||||.|  |:.|:....         .:.|..:|.|
Human   408 NHK------------------HQPGEYIFHAENDD--AQFTKMFTL---------NIRRKPQVLA 443

  Fly   241 EAVHRACVLAHQADC-------PLYVVHVMSKSA---------GIELARARHRYRGRYIMGETL- 288
            ||      .|.||.|       |.:.....|..:         |:...:|..:..|:::...|| 
Human   444 EA------SASQASCFSDGYPLPSWTWKKCSDKSPNCTEEITEGVWNRKANRKVFGQWVSSSTLN 502

  Fly   289 --AAALGTDATCCQH--LGFDAEAAHVLSP---PLRPDKTT--------------------PEFL 326
              .|..|....||.:  ||...|...:.||   |...|..:                    .::.
Human   503 MSEAIKGFLVKCCAYNSLGTSCETILLNSPGPFPFIQDNISFYATIGVCLLFIVVLTLLICHKYK 567

  Fly   327 MKLLANDDLQL---TG-SDN---------------CTFNKEH----KALGKGDFTKIPN 362
            .:......||:   || |||               ..|.:|:    |.||.|.|.|:.|
Human   568 KQFRYESQLQMVQVTGSSDNEYFYVDFREYEYDLKWEFPRENLEFGKVLGSGAFGKVMN 626

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CRMPNP_730954.2 D-HYD 22..475 CDD:238639 89/444 (20%)
PRK09060 24..483 CDD:181632 89/442 (20%)
FLT3NP_004110.2 ig 256..345 CDD:278476 20/118 (17%)
PKc_like 572..947 CDD:304357 16/56 (29%)
Important for normal regulation of the kinase activity and for maintaining the kinase in an inactive state in the absence of bound ligand 591..597 0/6 (0%)
Pkinase_Tyr 610..943 CDD:285015 7/18 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D174151at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.