DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CRMP and DPYSL3

Sequence 1:NP_730954.2 Gene:CRMP FlyBaseID:FBgn0023023 Length:594 Species:Drosophila melanogaster
Sequence 2:NP_001184223.1 Gene:DPYSL3 HGNCID:3015 Length:684 Species:Homo sapiens

Alignment Length:614 Identity:292/615 (47%)
Similarity:388/615 (63%) Gaps:53/615 (9%)


  Fly     2 STSPKPVKKVP--IHLQSA------QN--------RVYIKNGEIVNHDKSFKADVYIEDGIIKFV 50
            |..|.|....|  :.::||      ||        |:.||.|.|||.|:||.||:|:|||:||.:
Human    95 SREPAPASPAPAGVEIRSATGKEVLQNLGPKDKSDRLLIKGGRIVNDDQSFYADIYMEDGLIKQI 159

  Fly    51 GPSSEITIPGGVRTIDASGLMIIPGGIDPHTHMQLPFGGAVAVDDFYHGTKAAVAGGTTMIIDFV 115
            |  ..:.:||||:||:|:|.|:||||||.|||.|:|:.|...||||:.|||||:|||||||||.|
Human   160 G--DNLIVPGGVKTIEANGKMVIPGGIDVHTHFQMPYKGMTTVDDFFQGTKAALAGGTTMIIDHV 222

  Fly   116 LPNKHESMIEAYDKWRSWADPKVCCDYGLHVGITWWSKSVSEEIGILCKELGVNSFKTFMAYKGL 180
            :|....|:.|||:|||.|||.|.||||.|||.||.|:.||.:|:..|.|:.|||||..:||||.|
Human   223 VPEPESSLTEAYEKWREWADGKSCCDYALHVDITHWNDSVKQEVQNLIKDKGVNSFMVYMAYKDL 287

  Fly   181 YQLNDSDLLDVFERIRHLNGVAMVHAENGDIIAKNTQRLLAEGINGPEGHELSRPEEVEAEAVHR 245
            ||:::::|.::|..:..|..:|.||||||||||:...|:|..||.|||||.||||||:|||||.|
Human   288 YQVSNTELYEIFTCLGELGAIAQVHAENGDIIAQEQTRMLEMGITGPEGHVLSRPEELEAEAVFR 352

  Fly   246 ACVLAHQADCPLYVVHVMSKSAGIELARARHRYRGRYIMGETLAAALGTDATCCQHLGFDAEAAH 310
            |..:|.|.:|||||..||||||...:::||.  :|..:.||.:.|:||.|.|......:...||.
Human   353 AITIASQTNCPLYVTKVMSKSAADLISQARK--KGNVVFGEPITASLGIDGTHYWSKNWAKAAAF 415

  Fly   311 VLSPPLRPDKTTPEFLMKLLANDDLQLTGSDNCTFNKEHKALGKGDFTKIPNGVNGVEDRMSLVW 375
            |.||||.||.|||:::..|||:.||||:||.:|||:...||:||.:||.||.|.||||:|||::|
Human   416 VTSPPLSPDPTTPDYINSLLASGDLQLSGSAHCTFSTAQKAIGKDNFTAIPEGTNGVEERMSVIW 480

  Fly   376 EKGVHAGLLDPCRFVAVTSTNAAKIFNIYPQKGRIAVGSDADIVIWNPNATRTISKDTHHHACDF 440
            :|.|..|.:|..:||||||||||||||:||:||||:||||:|:|||:|:|.:.:|...|..|.::
Human   481 DKAVATGKMDENQFVAVTSTNAAKIFNLYPRKGRISVGSDSDLVIWDPDAVKIVSAKNHQSAAEY 545

  Fly   441 NIFEGMTVHGVCEFVLVRGRICAERGNVRVAEGFGRFIPTPVRPPFVYDIIEGKVQSQPEEQHEE 505
            ||||||.:.|....|:.:|:|..|.||:.|.:|.|||||......:||..|:.:           
Human   546 NIFEGMELRGAPLVVICQGKIMLEDGNLHVTQGAGRFIPCSPFSDYVYKRIKAR----------- 599

  Fly   506 KQNGSMAKRFAELD------IQIPVQEPISAMLAGNLAMPAEGS-LCSTPSVRGRVDGKRDLQES 563
                   ::.|:|.      ...||.:..:....|..|..|.|| ....|.|       |:|.:|
Human   600 -------RKMADLHAVPRGMYDGPVFDLTTTPKGGTPAGSARGSPTRPNPPV-------RNLHQS 650

  Fly   564 SFSISEELDRSGVRACIK-VKNPPGGKSS 591
            .||:|......|||:..| :..||||:|:
Human   651 GFSLSGTQVDEGVRSASKRIVAPPGGRSN 679

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CRMPNP_730954.2 D-HYD 22..475 CDD:238639 249/453 (55%)
PRK09060 24..483 CDD:181632 254/459 (55%)
DPYSL3NP_001184223.1 D-hydantoinase 131..585 CDD:273937 254/458 (55%)
VOC 574..679 CDD:326334 36/130 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C61674347
eggNOG 1 0.900 E1_COG0044
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 571 1.000 Inparanoid score I1039
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D174151at33208
OrthoFinder 1 1.000 FOG0000190
OrthoInspector 1 1.000 T609346
orthoMCL 1 0.900 OOG5_127801
Panther 1 1.100 O PTHR11647
Phylome 1 0.910 0.846 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R5547
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
1110.830

Return to query results.
Submit another query.