DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CRMP and DPYSL2

Sequence 1:NP_730954.2 Gene:CRMP FlyBaseID:FBgn0023023 Length:594 Species:Drosophila melanogaster
Sequence 2:NP_001184222.1 Gene:DPYSL2 HGNCID:3014 Length:677 Species:Homo sapiens

Alignment Length:589 Identity:279/590 (47%)
Similarity:374/590 (63%) Gaps:41/590 (7%)


  Fly    14 HLQSAQNRVYIKNGEIVNHDKSFKADVYIEDGIIKFVGPSSEITIPGGVRTIDASGLMIIPGGID 78
            ::....:|:.||.|:|||.|:||.||:|:|||:||.:|  ..:.:||||:||:|...|:||||||
Human   114 NINDQSDRLLIKGGKIVNDDQSFYADIYMEDGLIKQIG--ENLIVPGGVKTIEAHSRMVIPGGID 176

  Fly    79 PHTHMQLPFGGAVAVDDFYHGTKAAVAGGTTMIIDFVLPNKHESMIEAYDKWRSWADPKVCCDYG 143
            .||..|:|..|..:.|||:.|||||:|||||||||.|:|....|::.|:|:||.|||.|.||||.
Human   177 VHTRFQMPDQGMTSADDFFQGTKAALAGGTTMIIDHVVPEPGTSLLAAFDQWREWADSKSCCDYS 241

  Fly   144 LHVGITWWSKSVSEEIGILCKELGVNSFKTFMAYKGLYQLNDSDLLDVFERIRHLNGVAMVHAEN 208
            |||.|:.|.|.:.||:..|.|:.|||||..:||:|..:||.|..:.:|...||.:..:|.|||||
Human   242 LHVDISEWHKGIQEEMEALVKDHGVNSFLVYMAFKDRFQLTDCQIYEVLSVIRDIGAIAQVHAEN 306

  Fly   209 GDIIAKNTQRLLAEGINGPEGHELSRPEEVEAEAVHRACVLAHQADCPLYVVHVMSKSAGIELAR 273
            |||||:..||:|..||.|||||.||||||||||||:||..:|:|.:||||:..|||||:...:|:
Human   307 GDIIAEEQQRILDLGITGPEGHVLSRPEEVEAEAVNRAITIANQTNCPLYITKVMSKSSAEVIAQ 371

  Fly   274 ARHRYRGRYIMGETLAAALGTDATCCQHLGFDAEAAHVLSPPLRPDKTTPEFLMKLLANDDLQLT 338
            ||.  :|..:.||.:.|:||||.:......:...||.|.||||.||.|||:||..||:..|||:|
Human   372 ARK--KGTVVYGEPITASLGTDGSHYWSKNWAKAAAFVTSPPLSPDPTTPDFLNSLLSCGDLQVT 434

  Fly   339 GSDNCTFNKEHKALGKGDFTKIPNGVNGVEDRMSLVWEKGVHAGLLDPCRFVAVTSTNAAKIFNI 403
            ||.:||||...||:||.:||.||.|.||.|:|||::|:|.|..|.:|..:|||||||||||:||:
Human   435 GSAHCTFNTAQKAVGKDNFTLIPEGTNGTEERMSVIWDKAVVTGKMDENQFVAVTSTNAAKVFNL 499

  Fly   404 YPQKGRIAVGSDADIVIWNPNATRTISKDTHHHACDFNIFEGMTVHGVCEFVLVRGRICAERGNV 468
            ||:|||||||||||:|||:|::.:|||..||:.:.::||||||...|....|:.:|:|..|.|.:
Human   500 YPRKGRIAVGSDADLVIWDPDSVKTISAKTHNSSLEYNIFEGMECRGSPLVVISQGKIVLEDGTL 564

  Fly   469 RVAEGFGRFIPTPVRPPFVYDIIEGKVQSQPEEQHEEKQNGSMAKRFAELD------IQIPVQEP 527
            .|.||.||:||....|.|||..|:.:                  .|.|||.      ...||.| 
Human   565 HVTEGSGRYIPRKPFPDFVYKRIKAR------------------SRLAELRGVPRGLYDGPVCE- 610

  Fly   528 ISAMLAGNLAMPAEGSLCSTPSVRGRVDGKRDLQESSFSIS-----EELDRSGVRACIKVKNPPG 587
              ..:......||  |...|...:.:....|:|.:|.||:|     :.:.|   |...::..|||
Human   611 --VSVTPKTVTPA--SSAKTSPAKQQAPPVRNLHQSGFSLSGAQIDDNIPR---RTTQRIVAPPG 668

  Fly   588 GKSS 591
            |:::
Human   669 GRAN 672

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CRMPNP_730954.2 D-HYD 22..475 CDD:238639 246/453 (54%)
PRK09060 24..483 CDD:181632 250/459 (54%)
DPYSL2NP_001184222.1 D-HYD 122..571 CDD:238639 246/453 (54%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C61716404
eggNOG 1 0.900 E1_COG0044
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 571 1.000 Inparanoid score I1039
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D174151at33208
OrthoFinder 1 1.000 FOG0000190
OrthoInspector 1 1.000 T609346
orthoMCL 1 0.900 OOG5_127801
Panther 1 1.100 O PTHR11647
Phylome 1 0.910 0.846 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
109.800

Return to query results.
Submit another query.