DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CRMP and DPYS

Sequence 1:NP_730954.2 Gene:CRMP FlyBaseID:FBgn0023023 Length:594 Species:Drosophila melanogaster
Sequence 2:XP_005250875.1 Gene:DPYS HGNCID:3013 Length:555 Species:Homo sapiens

Alignment Length:511 Identity:281/512 (55%)
Similarity:348/512 (68%) Gaps:49/512 (10%)


  Fly    17 SAQNRVYIKNGEIVNHDKSFKADVYIEDGIIKFVG-----PSSEITIPGGVRTIDASGLMIIPGG 76
            :|.:|:.|:.|.:||.|.|..|||.:|||:::.:|     |..   .|.|:|.:||:|.:::|||
Human     2 AAPSRLLIRGGRVVNDDFSEVADVLVEDGVVRALGHDLLPPGG---APAGLRVLDAAGKLVLPGG 63

  Fly    77 IDPHTHMQLPFGGAVAVDDFYHGTKAAVAGGTTMIIDFVLPNKHESMIEAYDKWRSWADPKVCCD 141
            ||.|||||.||.|:.::|||:.|||||::|||||||||.:|.|..|:|||::.||||||||||||
Human    64 IDTHTHMQFPFMGSRSIDDFHQGTKAALSGGTTMIIDFAIPQKGGSLIEAFETWRSWADPKVCCD 128

  Fly   142 YGLHVGITWWSKSVSEEIGILCKELGVNSFKTFMAYKGLYQLNDSDLLDVFERIRHLNGVAMVHA 206
            |.|||.:||||..|.||:.||.::.||||||.|||||.||.:.|.:|.:.|.|.:.:..:|.|||
Human   129 YSLHVAVTWWSDQVKEEMKILVQDKGVNSFKMFMAYKDLYMVTDLELYEAFSRCKEIGAIAQVHA 193

  Fly   207 ENGDIIAKNTQRLLAEGINGPEGHELSRPEEVEAEAVHRACVLAHQADCPLYVVHVMSKSAGIEL 271
            ||||:||:..:::||.||.|||||||.|||.|||||..||..:|...:||||:||||||||...:
Human   194 ENGDLIAEGAKKMLALGITGPEGHELCRPEAVEAEATLRAITIASAVNCPLYIVHVMSKSAAKVI 258

  Fly   272 ARARHRYRGRYIMGETLAAALGTDATCCQHLGFDAEAAHVLSPPLRPDKTTPEFLMKLLANDDLQ 336
            |.||.  .|:.:.||.:||:||||.|...:..:...|.||:.||||||.:||:|||.|||||||.
Human   259 ADARR--DGKVVYGEPIAASLGTDGTHYWNKEWHHAAHHVMGPPLRPDPSTPDFLMNLLANDDLT 321

  Fly   337 LTGSDNCTFNKEHKALGKGDFTKIPNGVNGVEDRMSLVWEKGVHAGLLDPCRFVAVTSTNAAKIF 401
            .||:||||||...|||||.|||||||||||||||||::||||||:|.:|..||||||||||||||
Human   322 TTGTDNCTFNTCQKALGKDDFTKIPNGVNGVEDRMSVIWEKGVHSGKMDENRFVAVTSTNAAKIF 386

  Fly   402 NIYPQKGRIAVGSDADIVIWNPNAT------------------------------------RTIS 430
            |:||:|||||||||||||||:|..|                                    ||||
Human   387 NLYPRKGRIAVGSDADIVIWDPKGTRGCRSCVAFSDNGSVYKTNMNLPLQCLANARVHMEERTIS 451

  Fly   431 KDTHHHACDFNIFEGMTVHGVCEFVLVRGRICAERGNVRVAEGFGRFIPTPVRPPF 486
            ..|||.|.:|||||||..|||....:.||::..|.|...|..|.|:|||   |.||
Human   452 AKTHHQAVNFNIFEGMVCHGVPLVTISRGKVVYEAGVFSVTAGDGKFIP---RKPF 504

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CRMPNP_730954.2 D-HYD 22..475 CDD:238639 272/494 (55%)
PRK09060 24..483 CDD:181632 276/500 (55%)
DPYSXP_005250875.1 D-HYD 7..496 CDD:238639 272/494 (55%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C61700413
eggNOG 1 0.900 E1_COG0044
Hieranoid 1 1.000
Homologene 1 1.000 H20359
Inparanoid 1 1.050 571 1.000 Inparanoid score I1039
Isobase 1 0.950 0.917438 Normalized mean entropy S1869
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000190
OrthoInspector 1 1.000 T609346
orthoMCL 1 0.900 OOG5_127801
Panther 1 1.100 LDO PTHR11647
Phylome 1 0.910 0.846 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R5547
TreeFam 1 0.960
User_Submission 00.000 Not matched by this tool.
1413.740

Return to query results.
Submit another query.