DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CRMP and dhp-2

Sequence 1:NP_730954.2 Gene:CRMP FlyBaseID:FBgn0023023 Length:594 Species:Drosophila melanogaster
Sequence 2:NP_501797.1 Gene:dhp-2 WormBaseID:WBGene00000964 Length:520 Species:Caenorhabditis elegans

Alignment Length:569 Identity:292/570 (51%)
Similarity:364/570 (64%) Gaps:57/570 (10%)


  Fly    24 IKNGEIVNHDKSFKADVYIEDGIIKFVGPSSEITIPGGVRTIDASGLMIIPGGIDPHTHMQLPFG 88
            ||||.|||.|..||:||.:.||.|..:.||.:.|  .|:..:||:..::|||||||||||||||.
 Worm     5 IKNGTIVNDDAIFKSDVLVLDGRIVEIAPSIQPT--PGLEVVDATDRLVIPGGIDPHTHMQLPFM 67

  Fly    89 GAVAVDDFYHGTKAAVAGGTTMIIDFVLPNKHESMIEAYDKWRSWADPKVCCDYGLHVGITWWSK 153
            |.:|.|||:.||:||||||||||||||:|.|.||::.|||:||.||||||.|||||.:.||.|..
 Worm    68 GEIAKDDFHRGTEAAVAGGTTMIIDFVIPTKGESLLVAYDRWRGWADPKVVCDYGLSMAITSWGP 132

  Fly   154 SVSEEIGILC-KELGVNSFKTFMAYKGLYQLNDSDLLDVFERIRHLNGVAMVHAENGDIIAKNTQ 217
            .:::|:.|:. .|.|:||||.|:||.|::.:.|.:......:...|..:|.||||||.:||:..:
 Worm   133 EIAKEMEIVTGAEYGINSFKFFLAYAGVFMVRDEEFYQGMIQCAKLRALARVHAENGSVIAERCE 197

  Fly   218 RLLAEGINGPEGHELSRPEEVEAEAVHRACVLAHQADCPLYVVHVMSKSAGIELARARHRYRGRY 282
            .||:.||.|||||..|||||:||||..|||.:|.||:|||||||||||  |...|.|.||.:|..
 Worm   198 HLLSSGITGPEGHTQSRPEELEAEATFRACTMASQANCPLYVVHVMSK--GAAAAIAHHRKKGAV 260

  Fly   283 IMGETLAAALGTDATCCQHLGFDAEAAHVLSPPLRPDKTTPEFLMKLLANDDLQLTGSDNCTFNK 347
            :.||.:||.|.||.:...:..:...|.:|:||||..|.:||..||||||..:|.||.:|||||:.
 Worm   261 VFGEPIAAGLATDGSHYYNEDWLHAARYVMSPPLSRDPSTPSALMKLLAAGELHLTATDNCTFDC 325

  Fly   348 EHKALGKGDFTKIPNGVNGVEDRMSLVWEKGVHAGLLDPCRFVAVTSTNAAKIFNIYPQKGRIAV 412
            :.|:|||.|||||||||||||||||:||:||||||::||.||||||||.||||||.|||||||||
 Worm   326 QQKSLGKDDFTKIPNGVNGVEDRMSVVWDKGVHAGIIDPMRFVAVTSTMAAKIFNCYPQKGRIAV 390

  Fly   413 GSDADIVIWNPNATRTISKDTHHHACDFNIFEGMTVHGVCEFVLVRGRICAERGNVRVAEGFGRF 477
            ||||||||||.||||||||||||||.||||||||.||||.|..:.|||.....|.::..:|.|:|
 Worm   391 GSDADIVIWNANATRTISKDTHHHAIDFNIFEGMQVHGVPEITISRGRTVWANGQLKTVQGSGQF 455

  Fly   478 IPTPVRPPFVYDIIEGKVQSQPEEQHEEKQNGSMAKRFAELDIQIPVQEPISAMLAGNLAMPAEG 542
            ||.......|:..::.:.::                           .||:...     .:|.|.
 Worm   456 IPLAPDSQIVFSAVDNRKKA---------------------------MEPVKID-----RIPYEP 488

  Fly   543 SLCSTPSVRGRVDGKRDLQESSFSISEELDRSGVRACIKVKNPPGGKSS 591
            |...||.....:                :.::.|||.|    ||||.||
 Worm   489 SALQTPDANANI----------------VVKAPVRAAI----PPGGASS 517

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CRMPNP_730954.2 D-HYD 22..475 CDD:238639 270/452 (60%)
PRK09060 24..483 CDD:181632 274/460 (60%)
dhp-2NP_501797.1 D-HYD 3..453 CDD:238639 270/452 (60%)
PRK09060 3..446 CDD:181632 269/445 (60%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C61679847
eggNOG 1 0.900 E1_COG0044
Hieranoid 1 1.000
Homologene 1 1.000 H20359
Inparanoid 1 1.050 553 1.000 Inparanoid score I604
Isobase 1 0.950 0.917438 Normalized mean entropy S1869
OMA 1 1.010
OrthoDB 1 1.010 D174151at33208
OrthoFinder 1 1.000 FOG0000190
OrthoInspector 1 1.000 T375173
orthoMCL 1 0.900 OOG5_127801
Panther 1 1.100 LDO PTHR11647
Phylome 1 0.910 0.670 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R5547
TreeFam 1 0.960
1514.750

Return to query results.
Submit another query.