DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CRMP and dhp-1

Sequence 1:NP_730954.2 Gene:CRMP FlyBaseID:FBgn0023023 Length:594 Species:Drosophila melanogaster
Sequence 2:NP_001021583.1 Gene:dhp-1 WormBaseID:WBGene00000963 Length:489 Species:Caenorhabditis elegans

Alignment Length:480 Identity:271/481 (56%)
Similarity:338/481 (70%) Gaps:8/481 (2%)


  Fly    24 IKNGEIVNHDKSFKADVYIEDGIIKFVGPSSEITIPGGVRTIDASGLMIIPGGIDPHTHMQLPFG 88
            ||||.:||.|..|||||.:.:|||..|.|:  ||.......|||:..::||||||||||||:|:.
 Worm     7 IKNGTVVNEDGMFKADVLVRNGIIVEVSPN--ITALPDTEVIDATDRLVIPGGIDPHTHMQMPYM 69

  Fly    89 GAVAVDDFYHGTKAAVAGGTTMIIDFVLPNKH--ESMIEAYDKWRSWADPKVCCDYGLHVGITWW 151
            |.|..|||..||:|||||||||||||..|:..  ||:|..|::|||||||||||||||.|.||.|
 Worm    70 GEVTKDDFLKGTEAAVAGGTTMIIDFCCPDHRNGESLIAGYNRWRSWADPKVCCDYGLSVAITMW 134

  Fly   152 SKSVSEEIGILCK-ELGVNSFKTFMAYKGLYQLNDSDLLDVFERIRHLNGVAMVHAENGDIIAKN 215
            ....:|::.|:.. |.||||||.:|||:....:.|.:|....:....|..:|.||.|||.:|.:.
 Worm   135 RPETAEQMAIITSPEFGVNSFKFYMAYENTLMVRDDELFRGMQECAKLRALARVHCENGSVIKEK 199

  Fly   216 TQRLLAEGINGPEGHELSRPEEVEAEAVHRACVLAHQADCPLYVVHVMSKSAGIELARARHRYRG 280
            ...|||:|:.|||||..|||||:||||.:||||||.||:||:|:||||:|  |...|.:.||.:|
 Worm   200 EIDLLAKGVTGPEGHTQSRPEEIEAEATNRACVLAAQANCPVYIVHVMTK--GAASAISHHRAQG 262

  Fly   281 RYIMGETLAAALGTDATCCQHLGFDAEAAHVLSPPLRPDKTTPEFLMKLLANDDLQLTGSDNCTF 345
            ..:.||.:||.|..|.:...:..:...|.:|:||||..|.||||.||||||..:|.|||:||||:
 Worm   263 SIVFGEPIAAGLALDGSHYYNEDWLHAARYVMSPPLSRDPTTPELLMKLLAAGELHLTGTDNCTY 327

  Fly   346 NKEHKALGKGDFTKIPNGVNGVEDRMSLVWEKGVHAGLLDPCRFVAVTSTNAAKIFNIYPQKGRI 410
            :...|:||||:|||||||:||||||||:|||||||:|::||.|:|::||:.|||||||||:||||
 Worm   328 DCRQKSLGKGNFTKIPNGINGVEDRMSVVWEKGVHSGIIDPMRYVSITSSTAAKIFNIYPRKGRI 392

  Fly   411 AVGSDADIVIWNPNATRTISKDTHHHACDFNIFEGMTVHGVCEFVLVRGRICAERGNVRVAEGFG 475
            ||||||||||:|||||||||||||||..|||||||:..|||.|..:.||||....|.::...|.|
 Worm   393 AVGSDADIVIFNPNATRTISKDTHHHNLDFNIFEGINCHGVAEVTISRGRIVWAHGKLQTVPGSG 457

  Fly   476 RFIPTPVRPPFVYDIIEGKVQS-QP 499
            :|||.....|||:...|.:.|. ||
 Worm   458 KFIPLLANSPFVFSTHEKREQKIQP 482

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CRMPNP_730954.2 D-HYD 22..475 CDD:238639 260/454 (57%)
PRK09060 24..483 CDD:181632 264/462 (57%)
dhp-1NP_001021583.1 PRK09060 5..465 CDD:181632 264/462 (57%)
D-HYD 5..457 CDD:238639 260/454 (57%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C61683685
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000
Homologene 1 1.000 H20359
Inparanoid 1 1.050 553 1.000 Inparanoid score I604
Isobase 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D174151at33208
OrthoFinder 1 1.000 FOG0000190
OrthoInspector 1 1.000 T375173
orthoMCL 1 0.900 OOG5_127801
Panther 1 1.100 O PTHR11647
Phylome 1 0.910 0.670 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R5547
TreeFam 00.000 Not matched by this tool.
1211.940

Return to query results.
Submit another query.