DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CRMP and Dpysl2

Sequence 1:NP_730954.2 Gene:CRMP FlyBaseID:FBgn0023023 Length:594 Species:Drosophila melanogaster
Sequence 2:XP_006518571.1 Gene:Dpysl2 MGIID:1349763 Length:673 Species:Mus musculus

Alignment Length:604 Identity:286/605 (47%)
Similarity:379/605 (63%) Gaps:51/605 (8%)


  Fly     9 KKVPIHLQSAQ----------NRVYIKNGEIVNHDKSFKADVYIEDGIIKFVGPSSEITIPGGVR 63
            :||.|...|.:          :|:.||.|:|||.|:||.||:|:|||:||.:|  ..:.:||||:
Mouse    95 RKVEIRRASGKEALQNIYDQSDRLLIKGGKIVNDDQSFYADIYMEDGLIKQIG--ENLIVPGGVK 157

  Fly    64 TIDASGLMIIPGGIDPHTHMQLPFGGAVAVDDFYHGTKAAVAGGTTMIIDFVLPNKHESMIEAYD 128
            ||:|...|:||||||.||..|:|..|..:.|||:.|||||:|||||||||.|:|....|::.|:|
Mouse   158 TIEAHSRMVIPGGIDVHTRFQMPDQGMTSADDFFQGTKAALAGGTTMIIDHVVPEPGTSLLAAFD 222

  Fly   129 KWRSWADPKVCCDYGLHVGITWWSKSVSEEIGILCKELGVNSFKTFMAYKGLYQLNDSDLLDVFE 193
            :||.|||.|.||||.|||.||.|.|.:.||:..|.|:.|||||..:||:|..:||.||.:.:|..
Mouse   223 QWREWADSKSCCDYSLHVDITEWHKGIQEEMEALVKDHGVNSFLVYMAFKDRFQLTDSQIYEVLS 287

  Fly   194 RIRHLNGVAMVHAENGDIIAKNTQRLLAEGINGPEGHELSRPEEVEAEAVHRACVLAHQADCPLY 258
            .||.:..:|.||||||||||:..||:|..||.|||||.||||||||||||:|:..:|:|.:||||
Mouse   288 VIRDIGAIAQVHAENGDIIAEEQQRILDLGITGPEGHVLSRPEEVEAEAVNRSITIANQTNCPLY 352

  Fly   259 VVHVMSKSAGIELARARHRYRGRYIMGETLAAALGTDATCCQHLGFDAEAAHVLSPPLRPDKTTP 323
            |..||||||...:|:||.  :|..:.||.:.|:||||.:......:...||.|.||||.||.|||
Mouse   353 VTKVMSKSAAEVIAQARK--KGTVVYGEPITASLGTDGSHYWSKNWAKAAAFVTSPPLSPDPTTP 415

  Fly   324 EFLMKLLANDDLQLTGSDNCTFNKEHKALGKGDFTKIPNGVNGVEDRMSLVWEKGVHAGLLDPCR 388
            :||..||:..|||:|||.:||||...||:||.:||.||.|.||.|:|||::|:|.|..|.:|..:
Mouse   416 DFLNSLLSCGDLQVTGSAHCTFNTAQKAVGKDNFTLIPEGTNGTEERMSVIWDKAVVTGKMDENQ 480

  Fly   389 FVAVTSTNAAKIFNIYPQKGRIAVGSDADIVIWNPNATRTISKDTHHHACDFNIFEGMTVHGVCE 453
            |||||||||||:||:||:||||:||||||:|||:|::.:|||..||:.|.::||||||...|...
Mouse   481 FVAVTSTNAAKVFNLYPRKGRISVGSDADLVIWDPDSVKTISAKTHNSALEYNIFEGMECRGSPL 545

  Fly   454 FVLVRGRICAERGNVRVAEGFGRFIPTPVRPPFVYDIIEGKVQSQPEEQHEEKQNGSMAKRFAEL 518
            .|:.:|:|..|.|.:.|.||.||:||....|.|||..|:.:                  .|.|||
Mouse   546 VVISQGKIVLEDGTLHVTEGSGRYIPRKPFPDFVYKRIKAR------------------SRLAEL 592

  Fly   519 D------IQIPVQEPISAMLAGNLAMPAEGSLCSTPSVRGRVDGKRDLQESSFSIS-----EELD 572
            .      ...||.|   ..:......||  |...|...:.:....|:|.:|.||:|     :.:.
Mouse   593 RGVPRGLYDGPVCE---VSVTPKTVTPA--SSAKTSPAKQQAPPVRNLHQSGFSLSGAQIDDNIP 652

  Fly   573 RSGVRACIKVKNPPGGKSS 591
            |   |...::..||||:::
Mouse   653 R---RTTQRIVAPPGGRAN 668

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CRMPNP_730954.2 D-HYD 22..475 CDD:238639 249/453 (55%)
PRK09060 24..483 CDD:181632 253/459 (55%)
Dpysl2XP_006518571.1 D-HYD 118..567 CDD:238639 249/453 (55%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C61673488
eggNOG 1 0.900 E1_COG0044
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 563 1.000 Inparanoid score I1068
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D174151at33208
OrthoFinder 1 1.000 FOG0000190
OrthoInspector 1 1.000 T616160
orthoMCL 1 0.900 OOG5_127801
Panther 1 1.100 O PTHR11647
Phylome 1 0.910 0.846 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
109.800

Return to query results.
Submit another query.