DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CRMP and DPYSL4

Sequence 1:NP_730954.2 Gene:CRMP FlyBaseID:FBgn0023023 Length:594 Species:Drosophila melanogaster
Sequence 2:NP_006417.2 Gene:DPYSL4 HGNCID:3016 Length:572 Species:Homo sapiens

Alignment Length:602 Identity:277/603 (46%)
Similarity:368/603 (61%) Gaps:60/603 (10%)


  Fly     9 KKVPIHLQSAQNRVYIKNGEIVNHDKSFKADVYIEDGIIKFVGPSSEITIPGGVRTIDASGLMII 73
            |.:|   :...:|:.|:.|.|||.|:||.|||::|||:||.:|  ..:.:|||::||||.|||::
Human     7 KSIP---RITSDRLLIRGGRIVNDDQSFYADVHVEDGLIKQIG--ENLIVPGGIKTIDAHGLMVL 66

  Fly    74 PGGIDPHTHMQLPFGGAVAVDDFYHGTKAAVAGGTTMIIDFVLPNKHESMIEAYDKWRSWADPKV 138
            |||:|.||.:|:|..|....|||..|||||:|||||||:|.|.|:...|::.||::||..||...
Human    67 PGGVDVHTRLQMPVLGMTPADDFCQGTKAALAGGTTMILDHVFPDTGVSLLAAYEQWRERADSAA 131

  Fly   139 CCDYGLHVGITWWSKSVSEEIGILCKELGVNSFKTFMAYKGLYQLNDSDLLDVFERIRHLNGVAM 203
            ||||.|||.||.|.:|:.||:..|.||.|||||..|||||...|.:||.:.::|..||.|..:|.
Human   132 CCDYSLHVDITRWHESIKEELEALVKEKGVNSFLVFMAYKDRCQCSDSQMYEIFSIIRDLGALAQ 196

  Fly   204 VHAENGDIIAKNTQRLLAEGINGPEGHELSRPEEVEAEAVHRACVLAHQADCPLYVVHVMSKSAG 268
            ||||||||:.:..:|||..||.|||||.||.|||||||||:||..:|.||:|||||..||||.|.
Human   197 VHAENGDIVEEEQKRLLELGITGPEGHVLSHPEEVEAEAVYRAVTIAKQANCPLYVTKVMSKGAA 261

  Fly   269 IELARARHRYRGRYIMGETLAAALGTDATCCQHLGFDAEAAHVLSPPLRPDKTTPEFLMKLLAND 333
            ..:|:|:.  ||..:.||.:.|:||||.:......:...||.|.|||:.||.||.:.|..||::.
Human   262 DAIAQAKR--RGVVVFGEPITASLGTDGSHYWSKNWAKAAAFVTSPPVNPDPTTADHLTCLLSSG 324

  Fly   334 DLQLTGSDNCTFNKEHKALGKGDFTKIPNGVNGVEDRMSLVWEKGVHAGLLDPCRFVAVTSTNAA 398
            |||:|||.:|||....||:||.:|..||.|.||:|:|||:||||.|.:|.:|...||||||||||
Human   325 DLQVTGSAHCTFTTAQKAVGKDNFALIPEGTNGIEERMSMVWEKCVASGKMDENEFVAVTSTNAA 389

  Fly   399 KIFNIYPQKGRIAVGSDADIVIWNPNATRTISKDTHHHACDFNIFEGMTVHGVCEFVLVRGRICA 463
            ||||.||:|||:|||||||:|||||.||:.||..||:...::|||||:...|....|:.:||:..
Human   390 KIFNFYPRKGRVAVGSDADLVIWNPKATKIISAKTHNLNVEYNIFEGVECRGAPAVVISQGRVAL 454

  Fly   464 ERGNVRVAEGFGRFIPTPVRPPFVYDIIEGKVQSQPEEQHEEKQNGSMAKRFAEL---------- 518
            |.|.:.|..|.|||:|....|.|||..|:.:                  .|.||:          
Human   455 EDGKMFVTPGAGRFVPRKTFPDFVYKRIKAR------------------NRLAEIHGVPRGLYDG 501

  Fly   519 ---DIQIPVQ----EPISAMLAGNLAMPAEGSLCSTPSVRGRVDGKRDLQESSFSI--SEELDRS 574
               ::.:|.:    .|..|...|.:::|.                .|:|.:|.||:  |:..|..
Human   502 PVHEVMVPAKPGSGAPARASCPGKISVPP----------------VRNLHQSGFSLSGSQADDHI 550

  Fly   575 GVRACIKVKNPPGGKSS 591
            ..|...|:..||||:|:
Human   551 ARRTAQKIMAPPGGRSN 567

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CRMPNP_730954.2 D-HYD 22..475 CDD:238639 243/453 (54%)
PRK09060 24..483 CDD:181632 247/459 (54%)
DPYSL4NP_006417.2 D-HYD 17..466 CDD:238639 243/453 (54%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C61688556
eggNOG 1 0.900 E1_COG0044
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 571 1.000 Inparanoid score I1039
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D174151at33208
OrthoFinder 1 1.000 FOG0000190
OrthoInspector 1 1.000 T609346
orthoMCL 1 0.900 OOG5_127801
Panther 1 1.100 O PTHR11647
Phylome 1 0.910 0.846 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
109.800

Return to query results.
Submit another query.