DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CRMP and LOC103692570

Sequence 1:NP_730954.2 Gene:CRMP FlyBaseID:FBgn0023023 Length:594 Species:Drosophila melanogaster
Sequence 2:XP_008762762.1 Gene:LOC103692570 RGDID:9135001 Length:469 Species:Rattus norvegicus

Alignment Length:495 Identity:223/496 (45%)
Similarity:293/496 (59%) Gaps:36/496 (7%)


  Fly   110 MIIDFVLPNKHESMIEAYDKWRSWADPKVCCDYGLHVGITWWSKSVSEEIGILCKELGVNSFKTF 174
            |||..|||:|..|::|||:|.|:.|||||||||.||||||||:..|..|:..|.:|.|||||:.|
  Rat     1 MIIGHVLPDKETSLVEAYEKCRALADPKVCCDYALHVGITWWAPKVKAEMETLVREKGVNSFQMF 65

  Fly   175 MAYKGLYQLNDSDLLDVFERIRHLNGVAMVHAENGDIIAKNTQRLLAEGINGPEGHELSRPEEVE 239
            |.||.||.|.||:|..||...|....:..||||||:::|:..:..|..||.||||.|:|.|||:|
  Rat    66 MTYKDLYMLRDSELYQVFHACRDFGAIPRVHAENGELVAEGAKEALDLGITGPEGIEISHPEELE 130

  Fly   240 AEAVHRACVLAHQADCPLYVVHVMSKSAGIELARARHRYRGRYIMGETLAAALGTDATCCQHLGF 304
            |||.||...:|::..||:|:|:|.|.|||..:|.|  :.:|:.::.||..|..........|..:
  Rat   131 AEATHRVITIANRTHCPIYLVNVSSISAGDVIAAA--KMQGKVVLAETTNAHATLTGLHYYHQDW 193

  Fly   305 DAEAAHVLSPPLRPDKTTPEFLMKLLANDDLQLTGSDNCTFNKEHKALGKGDFTKIPNGVNGVED 369
            ...||:|..||||.|..|..:||.|||||.|.:..||:..|..:.||:||.||||||:||:||:|
  Rat   194 SHAAAYVTVPPLRLDTNTSTYLMSLLANDTLNIVASDHRPFTTKQKAMGKEDFTKIPHGVSGVQD 258

  Fly   370 RMSLVWEKGVHAGLLDPCRFVAVTSTNAAKIFNIYPQKGRIAVGSDADIVIWNPNATRTISKDTH 434
            |||:|||:||..|.:|..|||||||:|||||.|:||:||||..|:|||:|:|:|.||:|||..|.
  Rat   259 RMSVVWERGVVGGKMDENRFVAVTSSNAAKILNLYPRKGRIIPGADADVVVWDPEATKTISASTQ 323

  Fly   435 HHACDFNIFEGMTVHGVCEFVLVRGRICAERGNVRVAEGFGRFIPTPVRPPFVYDIIEGKVQSQP 499
            ....|||::|.|..|||....:.|||:..|.|....|||.|:|.|....|..||           
  Rat   324 VQGGDFNLYENMRCHGVPLVTISRGRVVYENGVFMCAEGTGKFCPLRSFPDIVY----------- 377

  Fly   500 EEQHEEKQNGSMAKRFAELDIQIPVQEPISAMLAGNLAM---PAEGS----LCSTPS-VRGRVDG 556
                         |:..:.:..:.|:........|::|:   |.:..    |..||: ...|..|
  Rat   378 -------------KKLVQREKTLKVRGVDRTPYLGDVAVVVNPGKKEMGTPLADTPTRPVTRHGG 429

  Fly   557 KRDLQESSFSISEEL--DRSGVRACIKVKNPPGGKSSGFW 594
            .|||.|||||:|...  |....||..::..||||:|||.|
  Rat   430 MRDLHESSFSLSGSQIDDHVPKRASARILAPPGGRSSGIW 469

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CRMPNP_730954.2 D-HYD 22..475 CDD:238639 187/365 (51%)
PRK09060 24..483 CDD:181632 190/373 (51%)
LOC103692570XP_008762762.1 metallo-dependent_hydrolases 1..364 CDD:294200 187/365 (51%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C61702639
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D174151at33208
OrthoFinder 1 1.000 FOG0000190
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR11647
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
44.040

Return to query results.
Submit another query.