DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CRMP and LOC100911610

Sequence 1:NP_730954.2 Gene:CRMP FlyBaseID:FBgn0023023 Length:594 Species:Drosophila melanogaster
Sequence 2:XP_006239903.1 Gene:LOC100911610 RGDID:6492163 Length:229 Species:Rattus norvegicus

Alignment Length:253 Identity:107/254 (42%)
Similarity:141/254 (56%) Gaps:34/254 (13%)


  Fly   352 LGKGDFTKIPNGVNGVEDRMSLVWEKGVHAGLLDPCRFVAVTSTNAAKIFNIYPQKGRIAVGSDA 416
            :||.||||||:||:||:||||:|||:||..|.:|..|||||||:|||||.|:||:||||..|:||
  Rat     1 MGKEDFTKIPHGVSGVQDRMSVVWERGVVGGKMDENRFVAVTSSNAAKILNLYPRKGRIIPGADA 65

  Fly   417 DIVIWNPNATRTISKDTHHHACDFNIFEGMTVHGVCEFVLVRGRICAERGNVRVAEGFGRFIPTP 481
            |:|:|:|.||:|||..|.....|||::|.|..|||....:.|||:..|.|....|||.|:|.|..
  Rat    66 DVVVWDPEATKTISASTQVQGGDFNLYENMRCHGVPLVTISRGRVVYENGVFMCAEGTGKFCPLR 130

  Fly   482 VRPPFVYDIIEGKVQSQPEEQHEEKQNGSMAKRFAELDIQIPVQEPISAMLAGNLAM---PAEGS 543
            ..|..||                        |:..:.:..:.|:........|::|:   |.:..
  Rat   131 SFPDIVY------------------------KKLVQREKTLKVRGVDRTPYLGDVAVVVNPGKKE 171

  Fly   544 ----LCSTPS-VRGRVDGKRDLQESSFSISEEL--DRSGVRACIKVKNPPGGKSSGFW 594
                |..||: ...|..|.|||.|||||:|...  |....||..::..||||:|||.|
  Rat   172 MGTPLADTPTRPVTRHGGMRDLHESSFSLSGSQIDDHVPKRASARILAPPGGRSSGIW 229

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CRMPNP_730954.2 D-HYD 22..475 CDD:238639 71/123 (58%)
PRK09060 24..483 CDD:181632 74/131 (56%)
LOC100911610XP_006239903.1 metallo-dependent_hydrolases <1..124 CDD:294200 71/123 (58%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000190
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.