DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CRMP and LOC100498039

Sequence 1:NP_730954.2 Gene:CRMP FlyBaseID:FBgn0023023 Length:594 Species:Drosophila melanogaster
Sequence 2:XP_012826802.2 Gene:LOC100498039 XenbaseID:XB-GENE-5950267 Length:466 Species:Xenopus tropicalis

Alignment Length:509 Identity:135/510 (26%)
Similarity:208/510 (41%) Gaps:89/510 (17%)


  Fly    24 IKNGEIVNHDKSFKADVYIEDGIIKFVGPSSEITIPGGVRTIDASGLMIIPGGIDPHTHMQLPFG 88
            :::..:|..:....||:.|:||.|..:.|..:.:|..|.:.:||..|:::||.||||.|:..|  
 Frog    12 VRSRRVVTGNTISPADIIIKDGKIVGIQPWGKQSITVGSQLLDAGDLVVMPGIIDPHVHVNEP-- 74

  Fly    89 GAVAVDDFYHGTKAAVAGGTTMIIDFVLPNKHESMIEAYDKWRSWADPKVCCDYGLHVGITWWSK 153
            |....:.:...|:||.|||.|.|:|..|.:...:...:....:..|....|     .|.:.:|..
 Frog    75 GRTDWEGYSTATRAAAAGGITTIVDMPLNSLPPTTSVSNFLTKLKAAEGQC-----FVDVAFWGG 134

  Fly   154 SVS----EEIGILCKELGVNSFKTFMAYKGLYQLNDSDLLDVFERIRHL---NGVAMVHAE---- 207
            .:.    |.:.:|  ..||..||.|:...|:.:.....|:|:...:..|   |.|.:.|||    
 Frog   135 VIPGNQLELVPML--HAGVAGFKCFLISSGVPEFPHVSLMDLHSAMSELQGTNSVLLFHAEFDDP 197

  Fly   208 -----NGDIIAKNTQRLLAEGINGPEGHELSRPEEVEAEAVHRACVLAHQADCPLYVVHVMS--- 264
                 |||.:...|  .||           |||..:|..||.....|..|.....::||:.|   
 Frog   198 SRAPTNGDPMQYET--FLA-----------SRPPHMEVAAVEAVANLCLQYKVRCHIVHLSSAMA 249

  Fly   265 -------KSAGIEL-ARARHRYRGRYIMGETLAA-ALGTDAT---CCQHLGFDAEAAHVLSPPLR 317
                   |.||..| ....|.|.       ||:| .:...||   ||              ||:|
 Frog   250 LPIIRKAKKAGAPLTVETTHHYL-------TLSAEKIPPGATYFKCC--------------PPVR 293

  Fly   318 PDKTTPEFLMKLLANDDLQLTGSDNCTFNKEHKALGKGDFTKIPNGVNGVEDRMSLVWEKGVHAG 382
             :.:..|.|...|....:.:..||:.....:.|.|..|||.|...|:..::..:||.|......|
 Frog   294 -EHSNKEALWNALLQGHIDMVVSDHSPCTPDLKLLQDGDFLKAWGGICSLQLGLSLFWSSARSRG 357

  Fly   383 --LLDPCRFVAVTSTNAAKIFNIYPQKGRIAVGSDADIVIWNPNATRTISKDTHHHACDFNIFEG 445
              |||..|.:   |:|.||:.::..:||.|..|.|||:|||:|:....:.:.:.||......:.|
 Frog   358 FSLLDIPRLL---SSNPAKLSSLDGRKGAIKPGYDADLVIWDPDKEYQVHEASLHHKNKLTPYLG 419

  Fly   446 MTVHGVCEFVLVRGRICAERGNVRVAEGFGRFIPTPVRPPFVYDIIEGKVQSQP 499
            ..:.|..|..:|.|.:...:         ||..|.|...|.:...:|....|.|
 Frog   420 FQLCGETEATIVGGILVYYK---------GRHCPVPAGKPLLIQTMELPEPSDP 464

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CRMPNP_730954.2 D-HYD 22..475 CDD:238639 127/484 (26%)
PRK09060 24..483 CDD:181632 131/492 (27%)
LOC100498039XP_012826802.2 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0044
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D719800at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.