DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CRMP and dpysl5

Sequence 1:NP_730954.2 Gene:CRMP FlyBaseID:FBgn0023023 Length:594 Species:Drosophila melanogaster
Sequence 2:XP_002942399.3 Gene:dpysl5 XenbaseID:XB-GENE-6073088 Length:474 Species:Xenopus tropicalis

Alignment Length:493 Identity:234/494 (47%)
Similarity:304/494 (62%) Gaps:24/494 (5%)


  Fly   106 GGTTMIIDFVLPNKHESMIEAYDKWRSWADPKVCCDYGLHVGITWWSKSVSEEIGILCKELGVNS 170
            |||||:|..|.|:|..|:::||:|.||.|||||||||.||:|:||||..|..|:..|.:|.||||
 Frog     2 GGTTMVIGHVFPDKDVSLLDAYEKCRSLADPKVCCDYALHMGVTWWSPKVMAEMETLVREKGVNS 66

  Fly   171 FKTFMAYKGLYQLNDSDLLDVFERIRHLNGVAMVHAENGDIIAKNTQRLLAEGINGPEGHELSRP 235
            |:.||.||.||.|.||:|..||...:.|..||.|||||||::|:..:..|..||.||||.|:|||
 Frog    67 FQMFMTYKDLYMLRDSELYQVFRHCKDLGAVARVHAENGDLVAEGAKEALELGITGPEGIEISRP 131

  Fly   236 EEVEAEAVHRACVLAHQADCPLYVVHVMSKSAGIELARARHRYRGRYIMGETLAAALGTDATCCQ 300
            ||:||||||||..:|::..||||:|:|.|.|||..:|.|  :.:|:.:.|||..|....:.....
 Frog   132 EELEAEAVHRAITIANRTFCPLYLVNVSSMSAGDVVAAA--KMQGKSVYGETTTAHATLNGLHYY 194

  Fly   301 HLGFDAEAAHVLSPPLRPDKTTPEFLMKLLANDDLQLTGSDNCTFNKEHKALGKGDFTKIPNGVN 365
            |..:...||:|..||||.|..||.:||.|||||.|.:..||:.||..:.:|:||.||||||:||.
 Frog   195 HQEWSHAAAYVTVPPLRLDTNTPNYLMSLLANDSLNVVSSDHRTFTTKQRAMGKEDFTKIPHGVG 259

  Fly   366 GVEDRMSLVWEKGVHAGLLDPCRFVAVTSTNAAKIFNIYPQKGRIAVGSDADIVIWNPNATRTIS 430
            ||:||||::||:||..|.:|..||||:||:|||||.|:||:||||..|:|||||:|:|.||||||
 Frog   260 GVQDRMSVIWERGVVGGKMDENRFVAITSSNAAKIHNMYPRKGRIIPGADADIVVWDPEATRTIS 324

  Fly   431 KDTHHHACDFNIFEGMTVHGVCEFVLVRGRICAERGNVRVAEGFGRFIPTPVRPPFVYDIIEGKV 495
            ..|.....|.|::|.|..|||....:..||:..|.|....|||.|.|.|....|.|:|     |.
 Frog   325 ASTQVQGGDVNLYENMRCHGVPLVTISHGRVVYENGAFMCAEGSGCFFPMRTYPDFLY-----KK 384

  Fly   496 QSQPEEQHEEKQNGSMAKRFAELDIQIPVQEPISAMLAGNLAMPAEGS-LCSTPS-VRGRVDGKR 558
            ..|.|:...:|.          :| :.|.|..::  :..|......|| :..||: ...|..|.|
 Frog   385 MVQKEKTSSQKC----------VD-RTPYQGEVA--VVANSGKKETGSPMADTPTRPTTRHGGMR 436

  Fly   559 DLQESSFSIS--EELDRSGVRACIKVKNPPGGKSSGFW 594
            ||.||.||:|  :..|....||..::..||||:|||.|
 Frog   437 DLHESGFSLSGAQIDDHVPKRASARILAPPGGRSSGIW 474

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CRMPNP_730954.2 D-HYD 22..475 CDD:238639 195/369 (53%)
PRK09060 24..483 CDD:181632 198/377 (53%)
dpysl5XP_002942399.3 metallo-dependent_hydrolases 1..369 CDD:294200 195/369 (53%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C61676086
eggNOG 1 0.900 E1_COG0044
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D174151at33208
OrthoFinder 1 1.000 FOG0000190
OrthoInspector 00.000 Not matched by this tool.
Phylome 1 0.910 0.846 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
65.710

Return to query results.
Submit another query.