DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CRMP and dpys

Sequence 1:NP_730954.2 Gene:CRMP FlyBaseID:FBgn0023023 Length:594 Species:Drosophila melanogaster
Sequence 2:XP_002931585.1 Gene:dpys XenbaseID:XB-GENE-959927 Length:498 Species:Xenopus tropicalis

Alignment Length:499 Identity:289/500 (58%)
Similarity:356/500 (71%) Gaps:11/500 (2%)


  Fly    18 AQNRVYIKNGEIVNHDKSFKADVYIEDGIIKFVGPSSEITIPGGVRTIDASGLMIIPGGIDPHTH 82
            |.:.:.||.|:|||.|.|...|||:|:|:||.:|.:........::.|||:|.:::|||||.|||
 Frog     2 ASSCILIKGGKIVNADCSVLLDVYVENGLIKDIGENLRPDRCTDLKVIDAAGKLVMPGGIDTHTH 66

  Fly    83 MQLPFGGAVAVDDFYHGTKAAVAGGTTMIIDFVLPNKHESMIEAYDKWRSWADPKVCCDYGLHVG 147
            ||.||.|..:||||..||:|||||||||:|||.:|.|.||:||||:.|||||||||||||.|||.
 Frog    67 MQFPFMGTHSVDDFCIGTQAAVAGGTTMVIDFAIPKKGESLIEAYETWRSWADPKVCCDYSLHVA 131

  Fly   148 ITWWSKSVSEEIGILCKELGVNSFKTFMAYKGLYQLNDSDLLDVFERIRHLNGVAMVHAENGDII 212
            :||||..|.||:|||.::.||||||.|||||.||.:||.:|...|...:.:..:|.|||||||:|
 Frog   132 VTWWSDKVKEEMGILVRDKGVNSFKMFMAYKDLYMVNDPELYQAFSCCKDIGAIAQVHAENGDLI 196

  Fly   213 AKNTQRLLAEGINGPEGHELSRPEEVEAEAVHRACVLAHQADCPLYVVHVMSKSAGIELARARHR 277
            |:..:::|:.||.|||||||.|||||||||..||..:|:..:||||||||||||:...:|.||. 
 Frog   197 AEGAKKMLSLGITGPEGHELCRPEEVEAEATQRAVTIANSVNCPLYVVHVMSKSSAKVIANARR- 260

  Fly   278 YRGRYIMGETLAAALGTDATCCQHLGFDAEAAHVLSPPLRPDKTTPEFLMKLLANDDLQLTGSDN 342
             .|:.:.||.:||.||||.|...|..:...||.|:.||||||.:|||:||.|||||||..||:||
 Frog   261 -EGKVVFGEPIAAGLGTDGTNYWHHDWCHAAAFVMGPPLRPDPSTPEYLMNLLANDDLSTTGTDN 324

  Fly   343 CTFNKEHKALGKGDFTKIPNGVNGVEDRMSLVWEKGVHAGLLDPCRFVAVTSTNAAKIFNIYPQK 407
            ||||...|||||.|||||||||||||||||::||||||:|.:|..|||||||:||||||||||:|
 Frog   325 CTFNTCQKALGKDDFTKIPNGVNGVEDRMSVIWEKGVHSGKMDENRFVAVTSSNAAKIFNIYPRK 389

  Fly   408 GRIAVGSDADIVIWNPNATRTISKDTHHHACDFNIFEGMTVHGVCEFVLVRGRICAERGNVRVAE 472
            |:||:|||||||||:|.||||||..|||.|.:|||||||..|||....:..||:..|.|.:...|
 Frog   390 GKIAIGSDADIVIWDPQATRTISAQTHHQAVNFNIFEGMVCHGVPLVTIAGGRVVYENGMLHTME 454

  Fly   473 GFGRFIPTPVRPPFVYDIIEGKVQS-----QPEEQHEEKQNGSM 511
            |.|::||   |.||. |.:.|::..     ||.....|...|.:
 Frog   455 GHGKYIP---RKPFA-DYVYGRIHQRDAVCQPVPVQREPYKGDV 494

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CRMPNP_730954.2 D-HYD 22..475 CDD:238639 276/453 (61%)
PRK09060 24..483 CDD:181632 279/459 (61%)
dpysXP_002931585.1 D-HYD 6..457 CDD:238639 276/453 (61%)
PRK09060 7..458 CDD:181632 277/453 (61%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C61696604
eggNOG 1 0.900 E1_COG0044
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 H20359
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D174151at33208
OrthoFinder 1 1.000 FOG0000190
OrthoInspector 00.000 Not matched by this tool.
Phylome 1 0.910 0.846 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
87.720

Return to query results.
Submit another query.