DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CRMP and dpysl2

Sequence 1:NP_730954.2 Gene:CRMP FlyBaseID:FBgn0023023 Length:594 Species:Drosophila melanogaster
Sequence 2:NP_001121465.1 Gene:dpysl2 XenbaseID:XB-GENE-1010783 Length:656 Species:Xenopus tropicalis

Alignment Length:586 Identity:282/587 (48%)
Similarity:378/587 (64%) Gaps:35/587 (6%)


  Fly    14 HLQSAQNRVYIKNGEIVNHDKSFKADVYIEDGIIKFVGPSSEITIPGGVRTIDASGLMIIPGGID 78
            :|....:|:.||.|:|||.|:||.||:|:|||:||.:|  ..:.:||||:||:|.|.|:||||||
 Frog    93 NLNDKSDRLLIKGGKIVNDDQSFHADIYMEDGLIKQIG--ENLIVPGGVKTIEAHGRMVIPGGID 155

  Fly    79 PHTHMQLPFGGAVAVDDFYHGTKAAVAGGTTMIIDFVLPNKHESMIEAYDKWRSWADPKVCCDYG 143
            .||..|.|..|.|:.|||:.|||||:|||||||||.|:|....|::.|:|:||.|||.|.||||.
 Frog   156 VHTCFQKPCNGMVSSDDFFQGTKAALAGGTTMIIDHVVPEPGSSLLSAFDQWREWADTKSCCDYS 220

  Fly   144 LHVGITWWSKSVSEEIGILCKELGVNSFKTFMAYKGLYQLNDSDLLDVFERIRHLNGVAMVHAEN 208
            |||.||.|.|.|.||:..|.|:.|||||..:||||..|||.||.:.:||..||.:..:|.|||||
 Frog   221 LHVDITEWHKGVQEEMEALVKDHGVNSFLVYMAYKDQYQLTDSQIYEVFSVIRDIGAIAEVHAEN 285

  Fly   209 GDIIAKNTQRLLAEGINGPEGHELSRPEEVEAEAVHRACVLAHQADCPLYVVHVMSKSAGIELAR 273
            ||:||:...|:|.:||||||||.|||||||||||.:|:..:|:|.:|||||..|||||:...:|:
 Frog   286 GDVIAEEQLRILEQGINGPEGHVLSRPEEVEAEAANRSITIANQTNCPLYVTKVMSKSSAEVIAQ 350

  Fly   274 ARHRYRGRYIMGETLAAALGTDATCCQHLGFDAEAAHVLSPPLRPDKTTPEFLMKLLANDDLQLT 338
            ||.  :|..:.||.:.|:||||.:......:...||.|.||||.||.:||:||..||:..|||:.
 Frog   351 ARK--KGAVVYGEPITASLGTDGSHYWSKNWAKAAAFVTSPPLSPDPSTPDFLNSLLSCGDLQVC 413

  Fly   339 GSDNCTFNKEHKALGKGDFTKIPNGVNGVEDRMSLVWEKGVHAGLLDPCRFVAVTSTNAAKIFNI 403
            ||.:||||...||:||.:||.||.|.||.|:|||:||::.|.:|.:|..:||||||||||||||:
 Frog   414 GSSHCTFNTAQKAVGKDNFTLIPEGTNGAEERMSVVWDRAVVSGKMDENQFVAVTSTNAAKIFNL 478

  Fly   404 YPQKGRIAVGSDADIVIWNPNATRTISKDTHHHACDFNIFEGMTVHGVCEFVLVRGRICAERGNV 468
            ||:|||||||||||:|||:|::.||||..||:...::||||||...|....|:.:|:|..|.|.:
 Frog   479 YPRKGRIAVGSDADLVIWDPDSVRTISAKTHNSNVEYNIFEGMECRGSPLVVISQGKIVLEEGTL 543

  Fly   469 RVAEGFGRFIPTPVRPPFVYDIIEGKVQSQPEEQHEEKQNGSMAKRFAELDIQIP---VQEPISA 530
            ...||.||:||....|.:||..|:.:                  .|.|||. .:|   ...|:..
 Frog   544 HATEGSGRYIPRKPFPDYVYKRIKAR------------------SRLAELR-GVPRGLYDGPVCE 589

  Fly   531 MLAGNLAMPAEGSLCSTPSVRGRVDGKRDLQESSFSIS-----EELDRSGVRACIKVKNPPGGKS 590
            :.....|:....|..::|: :......|:|.:|.||:|     :.:.|   |...::..||||::
 Frog   590 VSVTPKAVTPASSAKTSPA-KQPAQPIRNLHQSGFSLSGAQVDDNIPR---RTTQRIVAPPGGRA 650

  Fly   591 S 591
            :
 Frog   651 N 651

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CRMPNP_730954.2 D-HYD 22..475 CDD:238639 251/453 (55%)
PRK09060 24..483 CDD:181632 255/459 (56%)
dpysl2NP_001121465.1 PRK09060 101..551 CDD:181632 252/454 (56%)
D-HYD 101..550 CDD:238639 251/453 (55%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D174151at33208
OrthoFinder 1 1.000 FOG0000190
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.