DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CRMP and dpys

Sequence 1:NP_730954.2 Gene:CRMP FlyBaseID:FBgn0023023 Length:594 Species:Drosophila melanogaster
Sequence 2:NP_001116535.1 Gene:dpys ZFINID:ZDB-GENE-070508-1 Length:500 Species:Danio rerio

Alignment Length:472 Identity:275/473 (58%)
Similarity:340/473 (72%) Gaps:4/473 (1%)


  Fly    17 SAQNRVYIKNGEIVNHDKSFKADVYIEDGIIKFVGPSSEITIPGGVRTIDASGLMIIPGGIDPHT 81
            :||:.:.||.|::||.|.|..||||||||:|..||  :::.:..|.|.|||:..:::|||||.||
Zfish     2 TAQSCILIKGGKVVNEDFSVMADVYIEDGVISGVG--TDLQVAAGTRVIDATHKLVLPGGIDSHT 64

  Fly    82 HMQLPFGGAVAVDDFYHGTKAAVAGGTTMIIDFVLPNKHESMIEAYDKWRSWADPKVCCDYGLHV 146
            ||:|.|.|....|||..||:||||||||||:|||:..|..|::|||::||..|||||||||.||:
Zfish    65 HMELSFMGTTTADDFQTGTQAAVAGGTTMILDFVIAQKGCSLLEAYERWRRTADPKVCCDYSLHM 129

  Fly   147 GITWWSKSVSEEIGILCKELGVNSFKTFMAYKGLYQLNDSDLLDVFERIRHLNGVAMVHAENGDI 211
            .:|||..:|.:|:..|..|.|:||||.|||||.||.|.|.:|..||...:.:..:|.|||||||:
Zfish   130 AVTWWDDTVKKEMETLVSEKGINSFKMFMAYKDLYMLQDLELYAVFSTCKEIGAIAQVHAENGDL 194

  Fly   212 IAKNTQRLLAEGINGPEGHELSRPEEVEAEAVHRACVLAHQADCPLYVVHVMSKSAGIELARARH 276
            ||:..:|:|:.||.||||||:.|||||||||..||..:||..:|||||||||||||...:|.||.
Zfish   195 IAEGAKRMLSLGITGPEGHEMCRPEEVEAEATQRAITIAHATNCPLYVVHVMSKSAAKVVANARR 259

  Fly   277 RYRGRYIMGETLAAALGTDATCCQHLGFDAEAAHVLSPPLRPDKTTPEFLMKLLANDDLQLTGSD 341
              .||.:.||.:||.||||.|...|..:...|..|:.||||||.:||.:||.|||||||.:||:|
Zfish   260 --NGRLVFGEPIAAGLGTDGTHYWHENWAHAAGFVMGPPLRPDPSTPGYLMDLLANDDLSVTGTD 322

  Fly   342 NCTFNKEHKALGKGDFTKIPNGVNGVEDRMSLVWEKGVHAGLLDPCRFVAVTSTNAAKIFNIYPQ 406
            ||||:...|||||.|||||||||||||||||::||||||:|.:|..|||||||||||||||:||:
Zfish   323 NCTFSVCQKALGKDDFTKIPNGVNGVEDRMSVIWEKGVHSGKMDENRFVAVTSTNAAKIFNLYPR 387

  Fly   407 KGRIAVGSDADIVIWNPNATRTISKDTHHHACDFNIFEGMTVHGVCEFVLVRGRICAERGNVRVA 471
            |||||.|||||:|||:|.|:|.||..|||.|.|:||||||..|||....:.||::..|.|.:...
Zfish   388 KGRIAKGSDADLVIWDPKASRVISAKTHHQAVDYNIFEGMLCHGVPVVTISRGKVVYENGKLFTK 452

  Fly   472 EGFGRFIPTPVRPPFVY 488
            .|.||:||......|||
Zfish   453 PGEGRYIPRKPFAEFVY 469

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CRMPNP_730954.2 D-HYD 22..475 CDD:238639 266/453 (59%)
PRK09060 24..483 CDD:181632 270/459 (59%)
dpysNP_001116535.1 PRK09060 1..455 CDD:181632 268/457 (59%)
D-HYD 7..456 CDD:238639 266/453 (59%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C61711800
eggNOG 1 0.900 E1_COG0044
Hieranoid 1 1.000
Homologene 1 1.000 H20359
Inparanoid 1 1.050 561 1.000 Inparanoid score I1040
OMA 1 1.010
OrthoDB 1 1.010 D174151at33208
OrthoFinder 1 1.000 FOG0000190
OrthoInspector 1 1.000 T596953
orthoMCL 1 0.900 OOG5_127801
Panther 1 1.100 LDO PTHR11647
Phylome 1 0.910 0.846 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R5547
TreeFam 1 0.960
ZFIN 00.000 Not matched by this tool.
1413.800

Return to query results.
Submit another query.