DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2931 and Hrb27C

DIOPT Version :10

Sequence 1:NP_649552.1 Gene:CG2931 / 40673 FlyBaseID:FBgn0037342 Length:302 Species:Drosophila melanogaster
Sequence 2:NP_476869.1 Gene:Hrb27C / 33968 FlyBaseID:FBgn0004838 Length:421 Species:Drosophila melanogaster


Alignment Length:82 Identity:24/82 - (29%)
Similarity:44/82 - (53%) Gaps:4/82 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly   195 DDDFRIFCGDLGNDVNDEVLTRTFNKFPSFQRARVVRDKRTGKSKGFGFVSFREPADFIRAMKE- 258
            |:..::|.|.|..:...|.|:|.|.:|.......|:::..:|:|:|||||:|.:|.:....::. 
  Fly     4 DERGKLFVGGLSWETTQENLSRYFCRFGDIIDCVVMKNNESGRSRGFGFVTFADPTNVNHVLQNG 68

  Fly   259 ---MDGRYVGSRPIKLR 272
               :|||.:..:|...|
  Fly    69 PHTLDGRTIDPKPCNPR 85

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2931NP_649552.1 RRM_RBM42 192..274 CDD:409817 24/82 (29%)
Hrb27CNP_476869.1 RRM1_hnRNPA_hnRNPD_like 9..80 CDD:409763 21/70 (30%)
RRM2_DAZAP1 94..173 CDD:409765
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.