DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2931 and Rbmyf9

DIOPT Version :10

Sequence 1:NP_649552.1 Gene:CG2931 / 40673 FlyBaseID:FBgn0037342 Length:302 Species:Drosophila melanogaster
Sequence 2:NP_001257441.1 Gene:Rbmyf9 / 100041505 MGIID:3781554 Length:380 Species:Mus musculus


Alignment Length:93 Identity:34/93 - (36%)
Similarity:52/93 - (55%) Gaps:1/93 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly   195 DDDFRIFCGDLGNDVNDEVLTRTFNKFPSFQRARVVRDKRTGKSKGFGFVSFREPADFIRAMKEM 259
            |...:||.|.|......:.|...|.:|....|..::||:.|.||:||.|::||.|||...|:|||
Mouse     5 DQPGKIFIGGLNIKTRQKTLQEIFGRFGPVARVILMRDRETKKSRGFAFLTFRRPADAKNAVKEM 69

  Fly   260 DGRYVGSRPIKLRKSTWRQRSLDVVKKK 287
            :|..:..:.||::::. |..||:...||
Mouse    70 NGVILDGKRIKVKQAR-RPSSLESGSKK 96

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2931NP_649552.1 RRM_RBM42 192..274 CDD:409817 29/78 (37%)
Rbmyf9NP_001257441.1 RRM_SF 7..86 CDD:473069 28/79 (35%)
PABP-1234 <10..207 CDD:130689 33/88 (38%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 82..226 5/16 (31%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 279..358
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.