DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mia and Taf6l

DIOPT Version :8

Sequence 1:NP_001138010.1 Gene:mia / 40667 FlyBaseID:FBgn0014342 Length:589 Species:Drosophila melanogaster
Sequence 2:NP_666204.2 Gene:Taf6l / 225895 MGIID:2444957 Length:623 Species:Mus musculus

Alignment Length:504 Identity:120/504 - (23%)
Similarity:200/504 - (39%) Gaps:124/504 - (24%)


  Fly    12 MKTSQNEMPDKDKSFRRHSLSPRSLSAIFFHSTGLHLDDGVAQWLSINVKEDITNLLNEA----G 72
            |::|...|.::::  ||....||....:...||||.|.|.||..|:    ||:...|.||    .
Mouse     1 MQSSTGAMSEREE--RRFVEIPRESVRLMAESTGLELSDEVAALLA----EDVCYRLREATQNSS 59

  Fly    73 KYMRRIRDRRLQLSHIQHAVRMH--DDLC-YDIFFRLVHCDDCKMPPSQKV--LKTVREAVTAEK 132
            ::|:..:.|:|.:.....|:|..  :.:| |.               ||:.  |:..||......
Mouse    60 QFMKHTKRRKLTVEDFNRALRWSSVEAVCGYG---------------SQEALPLRPAREGDLYFP 109

  Fly   133 KDELLVSYPESVQESVPEPVPETSLEPPPMHTGWLKVEQVLLK----PSKRYPLSMEQQNFFELV 193
            :|..:.....::..::|:...||::.   :|..:|..:..|..    ||....|:.:...:::.|
Mouse   110 EDREVSLVELALATNIPKGCAETAVR---VHVSYLDGKGNLAPQGSVPSAVSSLTDDLLKYYQQV 171

  Fly   194 TEACVGDLESRRVLALKAISTDPSLEELLPRLTKFIADAVAINVAQQNLPLLLYLMRMVRALLGN 258
            |.|.:||......:||:.:.|:..:..|||   .|:.....:.....:|..|..|:::.|:|:.|
Mouse   172 TRAVLGDDPQLMKVALQDLQTNSKIAALLP---YFVYVVSGVKSVSHDLEQLHRLLQVARSLIRN 233

  Fly   259 QRFSLLQYLHLLLPAVLSCLLAKQVCASPNS-EDHWALREYSGNIMAHIVRQFDAADNGILPRVI 322
            ....|..|:..|:.:||.|:| :.:.||.|. .|||.||:.:..:::||.     ..:|.|  |.
Mouse   234 PHLCLGPYVRSLVGSVLYCVL-EPLAASINPLNDHWTLRDGAALLLSHIF-----WTHGDL--VS 290

  Fly   323 GVYNKALLK---------KPLTTVFGAVIGLGKMGNHAVRACILPQLKYLSEHIDSHMAASNDSP 378
            |:|.:.||.         :||.:.:|||:||..:|..||...:.|   :|..:..:..|..:|  
Mouse   291 GLYQQILLSLQKVLTDPVRPLCSHYGAVVGLHALGWKAVERVLYP---HLPTYWTNLQAVLDD-- 350

  Fly   379 SSSVDRQAVKYIRHRLMKMCSPVLMGIHQPPDLPEEFMERYGSLGTLMSDGVTVMRTKKQAVAAA 443
             .||....||...|::                        ||::                   ..
Mouse   351 -YSVSNAQVKADGHKV------------------------YGAI-------------------LV 371

  Fly   444 KAEAELKLKNMATEHLNSRGKGSRSVGSNDLVSGTQLPKNGIRPTSQAP 492
            ..|..||:|..|.|. |..|.|.|                |.||....|
Mouse   372 AVERLLKMKAQAAEP-NRGGLGGR----------------GYRPAEDLP 403

Known Domains:


GeneSequenceDomainRegion External IDIdentity
miaNP_001138010.1 TAF6 33..352 CDD:173968 88/341 (26%)
TAF6 40..422 CDD:227426 99/404 (25%)
Taf6lNP_666204.2 TAF6 20..329 CDD:173968 88/341 (26%)
Globin_like 323..>381 CDD:304364 17/106 (16%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG5095
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D384329at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.