DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: mRpL44 and RNT1

Sequence 1:NP_649541.1 Gene:mRpL44 FlyBaseID:FBgn0037330 Length:321 Species:Drosophila melanogaster
Sequence 2:NP_013966.1 Gene:RNT1 SGDID:S000004852 Length:471 Species:Saccharomyces cerevisiae

Alignment Length:274 Identity:51/275 (19%)
Similarity:98/275 (36%) Gaps:71/275 (26%)


  Fly    73 RLGESFELSELQRAFTEKSFAEREEDRRRQLGIEESDLQMPHNSDLVEKGQQIARAYVEAFLQHQ 137
            :|.|..:|:...|.|..||..      :.::.:..|::...||..|...|..|..:.:...:.::
Yeast   201 KLPEIQDLAIRARVFIHKSTI------KDKVYLSGSEMINAHNERLEFLGDSILNSVMTLIIYNK 259

  Fly   138 LPKVPNEGLQAIASYLLSTETLAH----------VSTHLGTKDLIQSTEYP-PSAESQAKSLHAV 191
            .|......|..:...|:|.|.:..          :.|:...||  :::.:. ...:..|....|.
Yeast   260 FPDYSEGQLSTLRMNLVSNEQIKQWSIMYNFHEKLKTNFDLKD--ENSNFQNGKLKLYADVFEAY 322

  Fly   192 IGALASS---SGIERAFIFVRDFICTQLNQKDLLEVWTPQEPIQLLEKICQERK------LGEA- 246
            ||.|...   :.:.:...::|     :|.:..:.|....|..::..:|:....|      :|.| 
Yeast   323 IGGLMEDDPRNNLPKIRKWLR-----KLAKPVIEEATRNQVALEKTDKLDMNAKRQLYSLIGYAS 382

  Fly   247 --------------EPRLLGDC--GKNTVLAAYQVGIYANRQLLGKGFGEDVKTATETAALDALQ 295
                          :|..:.:|  |..||              ||.|.|.::|.|...||.:||:
Yeast   383 LRLHYVTVKKPTAVDPNSIVECRVGDGTV--------------LGTGVGRNIKIAGIRAAENALR 433

  Fly   296 SIFDTRDNRRPFDF 309
                   :::..||
Yeast   434 -------DKKMLDF 440

Known Domains:


GeneSequenceDomainRegion External IDIdentity
mRpL44NP_649541.1 Rnc 72..296 CDD:223644 49/260 (19%)
RIBOc 81..219 CDD:197778 25/152 (16%)
RNT1NP_013966.1 Rnc 183..440 CDD:223644 50/273 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0571
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR11207
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.