DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: mRpL44 and MRPL3

Sequence 1:NP_649541.1 Gene:mRpL44 FlyBaseID:FBgn0037330 Length:321 Species:Drosophila melanogaster
Sequence 2:NP_013737.1 Gene:MRPL3 SGDID:S000004626 Length:390 Species:Saccharomyces cerevisiae

Alignment Length:381 Identity:68/382 (18%)
Similarity:143/382 (37%) Gaps:99/382 (26%)


  Fly    11 LARVKLLEGSPTVQTRRHIKRWVSPTLRELAHRQKKLGPQKPERRSGFVEWNQRSELFAFGKRLG 75
            |:....|:.|....::|::.      |..|..::|:..|:  ...:.:.|:.|           |
Yeast    34 LSSTCFLQQSSRFTSKRYLH------LSTLTQQEKRFLPE--SELAKYKEYYQ-----------G 79

  Fly    76 ESFELSELQRAFTEKSFAEREEDRRRQLGIEES-----------DLQMP---------------- 113
            ....::|:..:...||.:.|...:|.||..|.:           ..::|                
Yeast    80 LKSTVNEIPESVASKSPSLRTLHKRLQLPNELTYSTLSRCLTCPSAKLPDKINNPTKGAAFVNTV 144

  Fly   114 ------HNSDLVEKGQQIARAYVEAFLQHQLPKVPNEGLQAIASYLLSTETLAHVSTH------- 165
                  .|..|...|:.:...:|...:..:.|::|...|.|..:..:|...|||::.:       
Yeast   145 PTNKYLDNHGLNIMGKNLLSYHVTKSIIQKYPRLPTVVLNAAVNAYISEAVLAHIAKYWGIEVET 209

  Fly   166 --------------------------LGTKDLIQSTEYPPSAESQA-----KSLHAVIGALASSS 199
                                      |.:||.|:.......:|:.|     :|:.|.|.|:....
Yeast   210 TSVLSRYLKMEPFEFTLGRLKFFNNSLNSKDGIELITGKNFSETSALAMSVRSIIAAIWAVTEQK 274

  Fly   200 GIERAFIFVRDFICTQLNQKDLLEVWTPQEPIQLLEKICQERKLGEAEPRLLGDCGKNTVLAAYQ 264
            ..:..:.|:.|.|.::  :.|:.:::..::|.:.|..:|:...|.:...:|:.:.|:.:....:.
Yeast   275 DSQAVYRFIDDHIMSR--KLDITKMFQFEQPTRELAMLCRREGLEKPVSKLVAESGRLSKSPVFI 337

  Fly   265 VGIYANRQLLGKGFGEDVKTATETAALDALQS--IFDTRDNRRPFDFAIQLEPKTV 318
            |.:::..:.||:|:|..:|.|...||.|||..  .::....:.|.     ::|.||
Yeast   338 VHVFSGEETLGEGYGSSLKEAKARAATDALMKWYCYEPLAQQEPV-----IDPGTV 388

Known Domains:


GeneSequenceDomainRegion External IDIdentity
mRpL44NP_649541.1 Rnc 72..296 CDD:223644 54/295 (18%)
RIBOc 81..219 CDD:197778 34/209 (16%)
MRPL3NP_013737.1 Rnc 114..376 CDD:223644 45/264 (17%)
RIBOc 114..288 CDD:197778 26/174 (15%)
DSRM 303..371 CDD:214634 18/68 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0571
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 50 1.000 Inparanoid score I1819
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0005163
OrthoInspector 1 1.000 T1136545
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR11207
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R2919
TreeFam 00.000 Not matched by this tool.
66.080

Return to query results.
Submit another query.