DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: mRpL44 and Mrpl44

Sequence 1:NP_649541.1 Gene:mRpL44 FlyBaseID:FBgn0037330 Length:321 Species:Drosophila melanogaster
Sequence 2:NP_001074679.1 Gene:Mrpl44 MGIID:1916413 Length:333 Species:Mus musculus

Alignment Length:306 Identity:110/307 (36%)
Similarity:165/307 (54%) Gaps:12/307 (4%)


  Fly    20 SPTVQTRRHIKRWVSPTLRELAHRQKKLG-------PQKPERRSGFVEWNQRSELFAFGKRLGES 77
            :|.|.|.....|.|....|.....||:|.       |..|.|||....|:..:|:.|||.||.|:
Mouse    18 APAVPTLAPPVRGVKKGFRAAFRFQKELERWRLLRCPPPPVRRSEKPNWDYHAEVQAFGSRLQET 82

  Fly    78 FELSELQRAFTEKSFAEREEDRRRQLGIEESD--LQMPHNSDLVEKGQQIARAYVEAFLQHQLPK 140
            |.|..|:.||....:.:.||.:|:.||||:..  |.:..|.:|.|:|...:...:..||:.:.|.
Mouse    83 FSLDLLKTAFINSCYIKSEEAKRQSLGIEKEAALLNLKDNQELFEQGLSFSHRCLTQFLEDEFPD 147

  Fly   141 VPNEGLQAIASYLLSTETLAHVSTHLGTKDLIQSTEYPPSAESQAKSLHAVIGALASSSGIERAF 205
            :|.||.:::.|:|.....:.||:.:|..:.|..|.|:|.......::..||||||..|||.|||.
Mouse   148 LPAEGTESLVSFLTGEAVVCHVARNLAVEQLTLSAEFPVPLPVLRQTFFAVIGALLQSSGPERAA 212

  Fly   206 IFVRDFICTQLNQKDLLEVWTPQEPIQLLEKICQERKLGEAEPRLLGDCGKNTVLAAYQVGIYAN 270
            :|:|||:.||:..|:|.|:||...|:.||.:..::|.:...|.||....|..|.|..|.||:|.:
Mouse   213 LFIRDFLITQMTGKELFEMWTVVNPMGLLVEELKKRNISAPESRLTRQSGSTTALPLYFVGLYCD 277

  Fly   271 RQLLGKGFGEDVKTATETAALDALQSIFDTRDNRRPFDFAIQLEPK 316
            |:|:.:|.||.|..|.|.||..||:.::...:||||:|::   :||
Mouse   278 RKLIAEGPGETVLVAEEEAARVALRKLYGFTENRRPWDYS---KPK 320

Known Domains:


GeneSequenceDomainRegion External IDIdentity
mRpL44NP_649541.1 Rnc 72..296 CDD:223644 84/226 (37%)
RIBOc 81..219 CDD:197778 48/140 (34%)
Mrpl44NP_001074679.1 Rnc 77..305 CDD:223644 84/228 (37%)
DSRM 236..304 CDD:294045 26/68 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C154583745
eggNOG 1 0.900 E1_COG0571
Hieranoid 1 1.000
Homologene 1 1.000 H11293
Inparanoid 1 1.050 185 1.000 Inparanoid score I3918
Isobase 1 0.950 0 Normalized mean entropy S7566
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0005163
OrthoInspector 1 1.000 T1084624
orthoMCL 1 0.900 OOG5_133939
Panther 1 1.100 LDO PTHR11207
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R2919
TreeFam 1 0.960
1312.830

Return to query results.
Submit another query.