DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: mRpL44 and mrpl44

Sequence 1:NP_649541.1 Gene:mRpL44 FlyBaseID:FBgn0037330 Length:321 Species:Drosophila melanogaster
Sequence 2:NP_001025431.2 Gene:mrpl44 ZFINID:ZDB-GENE-050913-59 Length:332 Species:Danio rerio

Alignment Length:300 Identity:111/300 (37%)
Similarity:170/300 (57%) Gaps:6/300 (2%)


  Fly    27 RHIKRWVSPTLRELAHRQKKLGPQKPERRSGFVEWNQRSELFAFGKRLGESFELSELQRAFTEKS 91
            |..|||:...:..:..:.|..||..|:.||....::..:|:.|||.||.|||.:..|:.||....
Zfish    30 REKKRWMKAYMFVMRKKLKLEGPPAPKPRSEQPNFDYHAEVEAFGVRLQESFSVDLLKTAFVNSC 94

  Fly    92 FAEREEDRRRQLGI--EESDLQMPHNSDLVEKGQQIARAYVEAFLQHQLPKVPNEGLQAIASYLL 154
            :...|.:||:.||:  |.:.|.:..|::|.:.||.....::..:.::..|.:|:||:.|||.:|.
Zfish    95 YLRSEVERRKALGLDSESAILNLKDNTELRDHGQHFTTGFLSDWCKNSFPNLPDEGVAAIAGHLT 159

  Fly   155 STETLAHVSTHLGTKDLIQSTEYPPSAESQAKSLHAVIGALASSSGIERAFIFVRDFICTQLNQK 219
            .:|.:.||:.:|..::|..|.|:|........:..||||||..|||..||.:|:|||:.|||..|
Zfish   160 GSEVICHVARNLAVEELTMSAEFPVPDHILQGTFFAVIGALEQSSGPVRAGLFIRDFLVTQLIGK 224

  Fly   220 DLLEVWTPQEPIQLLEKICQERKLGEAEPRLLGDCGKNTVLAAYQVGIYANRQLLGKGFGEDVKT 284
            ||.::|...:|:.||.:....:.:...||||:...|.:|||..|.||:|::|:||.:|.||.|..
Zfish   225 DLFDMWKVVDPMGLLVEELTRKGVALPEPRLIRSAGASTVLPLYFVGLYSDRKLLAQGPGETVLI 289

  Fly   285 ATETAALDALQSIFDTRDNRRPFDFAI---QLE-PKTVRL 320
            |.|.||..||:.::...:|||||||..   ||: |.|..|
Zfish   290 AEEEAARVALRKLYGFTENRRPFDFTAPRDQLQKPSTQAL 329

Known Domains:


GeneSequenceDomainRegion External IDIdentity
mRpL44NP_649541.1 Rnc 72..296 CDD:223644 85/226 (38%)
RIBOc 81..219 CDD:197778 48/140 (34%)
mrpl44NP_001025431.2 Rnc <143..303 CDD:223644 66/160 (41%)
DSRM 234..302 CDD:294045 28/68 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C154583453
eggNOG 1 0.900 E1_COG0571
Hieranoid 1 1.000
Homologene 1 1.000 H11293
Inparanoid 1 1.050 190 1.000 Inparanoid score I3813
OMA 1 1.010
OrthoDB 1 1.010 D533666at33208
OrthoFinder 1 1.000 FOG0005163
OrthoInspector 1 1.000 T1053801
orthoMCL 1 0.900 OOG5_133939
Panther 1 1.100 LDO PTHR11207
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R2919
TreeFam 1 0.960
ZFIN 00.000 Not matched by this tool.
1312.890

Return to query results.
Submit another query.